Commit Graph

172 Commits

Author SHA1 Message Date
e6350b15dd app/core/gimpimage-duplicate.c (gimp_image_duplicate) a somewhat hackish
2006-08-29  Sven Neumann  <sven@gimp.org>

	* app/core/gimpimage-duplicate.c (gimp_image_duplicate)
	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_image): a
	somewhat hackish implementation of what's suggested in bug #353246.
	Let the save dialog default to the folder of the duplicated image.
2006-08-29 09:55:34 +00:00
0005f0ff5d app/pdb/Makefile.am app/pdb/gimppluginprocedure.[ch] removed these
2006-08-05  Michael Natterer  <mitch@gimp.org>

	* app/pdb/Makefile.am
	* app/pdb/gimppluginprocedure.[ch]
	* app/pdb/gimptemporaryprocedure.[ch]: removed these files...

	* app/plug-in/Makefile.am
	* app/plug-in/gimppluginprocedure.[ch]
	* app/plug-in/gimptemporaryprocedure.[ch]: ...and added them here.

	* app/Makefile.am
	* app/config/Makefile.am: reordered stuff to make it link again.

	* app/pdb/gimppdb.c: removed gimp_pdb_eek() hack.

	* app/actions/plug-in-actions.c
	* app/dialogs/file-save-dialog.c
	* app/file/file-open.c
	* app/file/file-save.c
	* app/file/file-utils.c
	* app/menus/plug-in-menus.c
	* app/plug-in/gimpplugin-message.c
	* app/plug-in/gimpplugin-progress.c
	* app/plug-in/gimpplugin.c
	* app/plug-in/gimppluginmanager-call.c
	* app/plug-in/gimppluginmanager-file.c
	* app/plug-in/gimppluginmanager-query.c
	* app/plug-in/gimppluginmanager.c
	* app/plug-in/gimppluginprocframe.c
	* app/plug-in/plug-in-def.c
	* app/plug-in/plug-in-rc.c
	* app/widgets/gimpfiledialog.c
	* app/widgets/gimpfileprocview.c
	* app/widgets/gimppluginaction.c
	* app/xcf/xcf.c
	* tools/pdbgen/pdb/plug_in.pdb: changed includes accordingly.

	* app/pdb/plug_in_cmds.c: regenerated.
2006-08-05 21:21:01 +00:00
8ae28a136c use file_utils_uri_display_basename() instead of g_path_get_basename() to
2006-07-18  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_image): use
	file_utils_uri_display_basename() instead of g_path_get_basename()
	to get an uri's basename. Fixes bug #347544.
2006-07-18 08:44:14 +00:00
03c929240d don't try to set "." as current_folder_uri.
2006-06-20  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_image): don't
	try to set "." as current_folder_uri.
2006-06-20 18:35:00 +00:00
c24c1fe064 always call gtk_file_chooser_set_current_folder_uri() and
2006-06-16  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_image):
	always call gtk_file_chooser_set_current_folder_uri() and
	gtk_file_chooser_set_current_name() instead of
	gtk_file_chooser_set_uri(), since the latter only works if the
	file exists and its return value is bogus. Fixes bug #343284.
2006-06-17 09:32:30 +00:00
6ebcf700d1 removed erroneous semicolon after G_DEFINE_TYPE macros.
2006-05-15  Sven Neumann  <sven@gimp.org>

	* app/*/*.c:
	* lib*/*.c: removed erroneous semicolon after G_DEFINE_TYPE macros.
2006-05-15 09:46:31 +00:00
95cc2ecb1e set the alternative button order here...
2006-05-08  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_new): set the
	alternative button order here...

	* app/dialogs/file-open-dialog.c (file_open_dialog_new)
	* app/dialogs/file-save-dialog.c (file_save_dialog_new): ...instead
	of here.
2006-05-08 15:43:21 +00:00
f1c3e79a4b app/plug-in/Makefile.am app/plug-in/plug-in-types.h new object which keeps
2006-04-29  Michael Natterer  <mitch@gimp.org>

	* app/plug-in/Makefile.am
	* app/plug-in/plug-in-types.h
	* app/plug-in/gimppluginmanager.[ch]: new object which keeps all
	plug-in related stuff that was kept in the Gimp instance. Has
	"menu-branch-added" and "last-plug-in-changed" signals.

	* app/plug-in/plug-ins.[ch]: removed, all its functions are in
	GimpPlugInManager now.

	* app/core/gimpmarshal.list: new marshaller for the new object.

	* app/core/gimp.[ch]: removed all plug-in related stuff and keep a
	GimpPlugInManager around.

	* app/plug-in/plug-in-data.[ch]
	* app/plug-in/plug-in-file.[ch]
	* app/plug-in/plug-in-help-domain.[ch]
	* app/plug-in/plug-in-locale-domain.[ch]
	* app/plug-in/plug-in-menu-branch.[ch]
	* app/plug-in/plug-ins-query.[ch]: removed...

	* app/plug-in/gimppluginmanager-data.[ch]
	* app/plug-in/gimppluginmanager-file.[ch]
	* app/plug-in/gimppluginmanager-help-domain.[ch]
	* app/plug-in/gimppluginmanager-locale-domain.[ch]
	* app/plug-in/gimppluginmanager-menu-branch.[ch]
	* app/plug-in/gimppluginmanager-query.[ch]: ...and added as
	methods of GimpPlugInManager.

	* app/plug-in/plug-in-debug.[ch]
	* app/plug-in/plug-in-shm.[ch]: removed...

	* app/plug-in/gimpplugindebug.[ch]
	* app/plug-in/gimppluginshm.[ch]: ...and added as properly
	namespeced structs with constructors and destructors.

	* app/core/Makefile.am
	* app/core/gimpenvirontable.[ch]
	* app/core/gimpinterpreterdb.[ch]: removed...

	* app/plug-in/gimpenvirontable.[ch]
	* app/plug-in/gimpinterpreterdb.[ch]: ...and added here unchanged.

	* app/core/gimp-gui.[ch]
	* app/gui/gui-vtable.c: remove gimp_menus_create_branch() and all
	related stuff.

	* app/actions/plug-in-actions.[ch]: connect to the
	plug-in-manager's "menu-path-added" signal and create menu branch
	actions accordingly.

	* app/plug-in/plug-in-context.c
	* app/plug-in/plug-in-message.c
	* app/plug-in/plug-in-progress.c
	* app/plug-in/plug-in-run.[ch]
	* app/plug-in/plug-in.[ch]
	* app/app_procs.c
	* app/actions/file-commands.c
	* app/actions/plug-in-commands.c
	* app/core/gimpimage.c
	* app/dialogs/file-open-location-dialog.c
	* app/dialogs/file-save-dialog.c
	* app/file/file-open.c
	* app/gui/gui.c
	* app/menus/plug-in-menus.c
	* app/pdb/gimppluginprocedure.c
	* app/pdb/gimptemporaryprocedure.c
	* app/widgets/gimpdnd-xds.c
	* app/widgets/gimpfiledialog.c
	* app/widgets/gimpfileprocview.c
	* app/widgets/gimphelp.c
	* app/widgets/gimpthumbbox.c
	* app/xcf/xcf.c
	* tools/pdbgen/pdb/context.pdb
	* tools/pdbgen/pdb/drawable.pdb
	* tools/pdbgen/pdb/fileops.pdb
	* tools/pdbgen/pdb/help.pdb
	* tools/pdbgen/pdb/message.pdb
	* tools/pdbgen/pdb/plug_in.pdb
	* tools/pdbgen/pdb/procedural_db.pdb
	* tools/pdbgen/pdb/progress.pdb
	* tools/pdbgen/pdb/undo.pdb: follow above refactoring.

	* app/pdb/context_cmds.c
	* app/pdb/drawable_cmds.c
	* app/pdb/fileops_cmds.c
	* app/pdb/help_cmds.c
	* app/pdb/message_cmds.c
	* app/pdb/plug_in_cmds.c
	* app/pdb/procedural_db_cmds.c
	* app/pdb/progress_cmds.c
	* app/pdb/undo_cmds.c: regenerated.
2006-04-28 22:26:51 +00:00
f65bd53e58 app/pdb/Makefile.am app/pdb/pdb-types.h new object GimpPDB which keeps all
2006-04-26  Michael Natterer  <mitch@gimp.org>

	* app/pdb/Makefile.am
	* app/pdb/pdb-types.h
	* app/pdb/gimppdb.[ch]: new object GimpPDB which keeps all
	procedures and functions to register and run them. Renamed all
	functions and did some cleanups.

	* app/pdb/gimp-pdb.[ch]
	* app/core/gimp.[ch]: removed the same stuff here.

	* app/pdb/gimp-pdb-query.[ch]: removed these files...

	* app/pdb/gimppdb-query.[ch]: ...added here as members of GimpPDB.

	* app/pdb/gimp-pdb-compat.h: fix include guard.

	* app/batch.c
	* app/actions/vectors-commands.c
	* app/dialogs/about-dialog.c
	* app/file/file-open.c
	* app/file/file-save.c
	* app/plug-in/plug-in-message.c
	* app/plug-in/plug-ins.c
	* app/widgets/gimpfiledialog.c
	* app/widgets/gimphelp.c
	* app/xcf/xcf.c
	* tools/pdbgen/pdb/brush_select.pdb
	* tools/pdbgen/pdb/fileops.pdb
	* tools/pdbgen/pdb/font_select.pdb
	* tools/pdbgen/pdb/gradient_select.pdb
	* tools/pdbgen/pdb/palette_select.pdb
	* tools/pdbgen/pdb/pattern_select.pdb
	* tools/pdbgen/pdb/procedural_db.pdb: changed includes and function
	calls accordingly.

	* tools/pdbgen/app.pl: pass around GimpPDB instead of Gimp
	pointers to register the internal procedures with. Changed some
	newlines in the generated code.

	* app/pdb/*_cmds.c
	* app/pdb/internal_procs.[ch]: regenerated.

	* app/core/gimppdbprogress.[ch]
	* app/widgets/gimppdbdialog.[ch]: added "pdb" CONSTRUCT_ONLY
	properties.

	* app/plug-in/plug-in-progress.c
	* app/gui/gui-vtable.c: pass gimp->pdb when creating them.

	* app/widgets/gimpbrushselect.c
	* app/widgets/gimpfontselect.c
	* app/widgets/gimpgradientselect.c
	* app/widgets/gimppaletteselect.c
	* app/widgets/gimppatternselect.c: use the new local pdb pointers
	instead of some foo->bar->gimp->pdb overkill.
2006-04-26 09:13:47 +00:00
1f8c1ae34e app/plug-in/Makefile.am app/plug-in/plug-ins-help.[ch] remove these files
2006-04-09  Michael Natterer  <mitch@gimp.org>

	* app/plug-in/Makefile.am
	* app/plug-in/plug-ins-help.[ch]
	* app/plug-in/plug-ins-locale.[ch]: remove these files again...

	* app/plug-in/plug-in-help-domain.[ch]
	* app/plug-in/plug-in-locale-domain.[ch]: ... and add them here
	with changed namespace.

	* app/plug-in/plug-in-menu-branch.[ch]: new files keeping menu
	branches registered by plug-ins.

	* app/plug-in/plug-ins.[ch]: removed the menu branch stuff here.

	* app/actions/plug-in-actions.c
	* app/menus/plug-in-menus.c
	* app/plug-in/plug-in.c
	* app/widgets/gimpfiledialog.c
	* app/widgets/gimpfileprocview.c
	* app/widgets/gimphelp.c
	* tools/pdbgen/pdb/help.pdb
	* tools/pdbgen/pdb/plug_in.pdb: changed accordingly.

	* app/pdb/help_cmds.c
	* app/pdb/plug_in_cmds.c: regenerated.
2006-04-09 21:04:37 +00:00
5cf5b8ca1c app/plug-in/Makefile.am app/plug-in/plug-ins-help.[ch] new files managing
2006-04-09  Michael Natterer  <mitch@gimp.org>

	* app/plug-in/Makefile.am
	* app/plug-in/plug-ins-help.[ch]
	* app/plug-in/plug-ins-locale.[ch]: new files managing plug-in
	help domains and locale domains.

	* app/plug-in/plug-ins.[ch]: removed the functions here. Minor
	unrelated cleanups.

	* app/plug-in/plug-in.c
	* app/actions/plug-in-actions.c
	* app/menus/plug-in-menus.c
	* app/widgets/gimpfiledialog.c
	* app/widgets/gimpfileprocview.c
	* app/widgets/gimphelp.c
	* tools/pdbgen/pdb/help.pdb
	* tools/pdbgen/pdb/plug_in.pdb: changed includes accordingly.

	* app/pdb/help_cmds.c
	* app/pdb/plug_in_cmds.c: regenerated.
2006-04-09 16:25:47 +00:00
7e258dfa27 app/plug-in/Makefile.am app/plug-in/plug-in-types.h removed...
2006-04-06  Michael Natterer  <mitch@gimp.org>

	* app/plug-in/Makefile.am
	* app/plug-in/plug-in-types.h
	* app/plug-in/plug-in-proc-def.[ch]: removed...

	* app/pdb/Makefile.am
	* app/pdb/pdb-types.h
	* app/pdb/gimppluginprocedure.[ch]: ...and added here. Virtualized
	get_progname().

	* app/pdb/gimptemporaryprocedure.[ch]: new class derived from
	GimpPlugInProcedure.

	* app/pdb/gimpprocedure.[ch] (struct GimpProcedure): remove union
	exec_method and all the structs it needed. Procedure execution is
	properly virtualized now. Removed gimp_procedure_initialize() and
	grow the args and values arrays dynamically in
	gimp_procedure_add_argument()/return_value(). Added marshal_func
	parameter to gimp_procedure_new().

	* app/actions/plug-in-actions.c
	* app/actions/plug-in-commands.c
	* app/core/gimp-gui.c
	* app/dialogs/file-save-dialog.c
	* app/file/file-open.c
	* app/file/file-save.c
	* app/file/file-utils.c
	* app/gui/gui-vtable.c
	* app/menus/plug-in-menus.c
	* app/plug-in/plug-in-def.c
	* app/plug-in/plug-in-message.c
	* app/plug-in/plug-in-progress.c
	* app/plug-in/plug-in-rc.c
	* app/plug-in/plug-in-run.c
	* app/plug-in/plug-in.c
	* app/plug-in/plug-ins-query.c
	* app/plug-in/plug-ins.c
	* app/widgets/gimpfiledialog.c
	* app/widgets/gimpfileprocview.c
	* app/widgets/gimppluginaction.c
	* app/xcf/xcf.c
	* tools/pdbgen/pdb/fileops.pdb
	* tools/pdbgen/pdb/plug_in.pdb
	* tools/pdbgen/app.pl: changed accordingly.

	* app/pdb/*_cmds.c: regenerated.

	* app/pdb/gimp-pdb.c: added uglyness to make the app link again.
2006-04-06 10:01:30 +00:00
086d0b6371 app/plug-in/plug-in-types.h renamed to GimpPlugInProcedure and made a
2006-04-05  Michael Natterer  <mitch@gimp.org>

	* app/plug-in/plug-in-types.h
	* app/plug-in/plug-in-proc-def.[ch]: renamed to GimpPlugInProcedure
	and made a GObject derived from GimpProcedure (instead of having
	a pointer to a GimpProcedure). Added image_types and file_magic
	utility functions taken from plug-ins.[ch]. Still lives in the
	same crappy files because I am undecided where to put it...

	* app/pdb/gimpprocedure.c (gimp_procedure_real_execute): removed
	switch() statement and always call the internal marshaller because
	GimpProcedure::execute() is properly overridden by
	GimpPlugInProcedure now.

	* app/plug-in/plug-ins.[ch]: removed the mime_type and file_magic
	utilities added to GimpPlugInProcedure.

	* app/actions/file-commands.c
	* app/actions/plug-in-actions.[ch]
	* app/actions/plug-in-commands.[ch]
	* app/core/gimp-gui.[ch]
	* app/core/gimp.[ch]
	* app/core/gimpimage.[ch]
	* app/dialogs/file-open-dialog.c
	* app/dialogs/file-save-dialog.c
	* app/dialogs/print-size-dialog.c
	* app/file/file-open.[ch]
	* app/file/file-save.[ch]
	* app/file/file-utils.[ch]
	* app/gui/gui-vtable.c
	* app/menus/plug-in-menus.[ch]
	* app/plug-in/plug-in-def.[ch]
	* app/plug-in/plug-in-message.c
	* app/plug-in/plug-in-rc.c
	* app/plug-in/plug-in-run.c
	* app/plug-in/plug-in.c
	* app/plug-in/plug-ins-query.c
	* app/widgets/gimpactiongroup.[ch]
	* app/widgets/gimpdnd-xds.c
	* app/widgets/gimpfiledialog.[ch]
	* app/widgets/gimpfileprocview.[ch]
	* app/widgets/gimppluginaction.[ch]
	* app/xcf/xcf.c
	* tools/pdbgen/pdb/fileops.pdb
	* tools/pdbgen/pdb/plug_in.pdb: changed addordingly.

	* app/pdb/fileops_cmds.c
	* app/pdb/plug_in_cmds.c: regenerated.
2006-04-05 08:38:33 +00:00
a184c9090b app/pdb/Makefile.am app/pdb/procedural_db.[ch] removed...
2006-04-04  Michael Natterer  <mitch@gimp.org>

	* app/pdb/Makefile.am
	* app/pdb/procedural_db.[ch]
	* app/pdb/procedural-db-query.[ch]: removed...

	* app/pdb/gimp-pdb.[ch]
	* app/pdb/gimp-pdb-query.[ch]: ...and added namespacefied.

	* app/batch.c
	* app/actions/vectors-commands.c
	* app/core/gimp.c
	* app/core/gimppdbprogress.c
	* app/dialogs/about-dialog.c
	* app/file/file-open.c
	* app/file/file-save.c
	* app/file/file-utils.c
	* app/plug-in/plug-in-message.c
	* app/plug-in/plug-in-params.c
	* app/plug-in/plug-in-proc-def.c
	* app/plug-in/plug-in-progress.c
	* app/plug-in/plug-ins-query.c
	* app/plug-in/plug-ins.c
	* app/widgets/gimpbrushselect.c
	* app/widgets/gimpfiledialog.c
	* app/widgets/gimpfontselect.c
	* app/widgets/gimpgradientselect.c
	* app/widgets/gimphelp.c
	* app/widgets/gimppaletteselect.c
	* app/widgets/gimppatternselect.c
	* app/widgets/gimppdbdialog.c
	* app/xcf/xcf.c
	* tools/pdbgen/app.pl
	* tools/pdbgen/pdb/brush_select.pdb
	* tools/pdbgen/pdb/fileops.pdb
	* tools/pdbgen/pdb/font_select.pdb
	* tools/pdbgen/pdb/gradient_select.pdb
	* tools/pdbgen/pdb/palette_select.pdb
	* tools/pdbgen/pdb/pattern_select.pdb
	* tools/pdbgen/pdb/procedural_db.pdb: changed accordingly.

	* app/pdb/*_cmds.c: regenerated.
2006-04-04 17:47:22 +00:00
1dac27836d app/pdb/Makefile.am new files containing the functions operating on *one*
2006-03-31  Michael Natterer  <mitch@gimp.org>

	* app/pdb/Makefile.am
	* app/pdb/gimpprocedure.[ch]: new files containing the functions
	operating on *one* procedure. Factored out of procedural_db.[ch]
	and renamed to gimp_procedure_foo().

	* app/pdb/procedural_db.[ch]: removed them here.

	* app/pdb/procedural-db-query.c
	* app/batch.c
	* app/actions/plug-in-commands.c
	* app/actions/vectors-commands.c
	* app/core/gimppdbprogress.c
	* app/file/file-open.c
	* app/file/file-save.c
	* app/plug-in/plug-in-message.c
	* app/plug-in/plug-in-proc-def.[ch]
	* app/plug-in/plug-in-progress.c
	* app/plug-in/plug-in-rc.c
	* app/plug-in/plug-in-run.c
	* app/plug-in/plug-ins.c
	* app/widgets/gimpfiledialog.c
	* app/widgets/gimphelp.c
	* app/widgets/gimppdbdialog.c
	* app/xcf/xcf.c
	* tools/pdbgen/pdb/fileops.pdb
	* tools/pdbgen/app.pl: changed #includes and function calls
	accordingly. No logic changed.

	* app/pdb/*_cmds.c: regenerated.
2006-03-31 09:15:08 +00:00
905fdfcbed did a global gimage -> image substitution.
2006-03-28  Sven Neumann  <sven@gimp.org>

	* app/*: did a global gimage -> image substitution.
2006-03-28 17:08:36 +00:00
e09c3f2da6 app/dialogs/vectors-import-dialog.c (vectors_import_dialog_new) fixed
2006-03-03  Sven Neumann  <sven@gimp.org>

	* app/dialogs/vectors-import-dialog.c (vectors_import_dialog_new)
	* app/widgets/gimpfiledialog.c (gimp_file_dialog_add_filters):
	fixed capitalization of filter names.
2006-03-03 22:46:01 +00:00
e397c0ef0a set the new "do-overwrite-confirmation" property on GtkFileChooser.
2005-12-28  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpfiledialog.[ch]: set the new
	"do-overwrite-confirmation" property on GtkFileChooser. Removed
	gimp_file_overwrite_dialog().

	* app/dialogs/file-save-dialog.c (file_save_dialog_check_uri):
	removed broken code which tried to figure if a file exists.
	Fixes bug #309729.

	* app/widgets/gimpdnd-xds.c: added gimp_file_overwrite_dialog()
	here as private utility function.
2005-12-28 20:02:54 +00:00
61df53ec54 port to G_DEFINE_TYPE() and friends. Some related cleanup.
2005-12-19  Michael Natterer  <mitch@gimp.org>

	* app/widgets/*.c: port to G_DEFINE_TYPE() and friends. Some
	related cleanup.
2005-12-19 22:37:49 +00:00
ee64ca3c90 introduced variants of file_utils_uri_to_utf8_filename() and
2005-10-02  Sven Neumann  <sven@gimp.org>

	* app/file/file-utils.[ch]: introduced variants of
	file_utils_uri_to_utf8_filename() and
	file_utils_uri_to_utf8_basename() that use g_filename_display_name()
	and g_filename_display_basename().

	* app/actions/data-commands.c
	* app/actions/documents-commands.c
	* app/actions/file-actions.c
	* app/actions/file-commands.c
	* app/core/gimpimage.c
	* app/core/gimpimagefile.c
	* app/dialogs/file-open-dialog.c
	* app/dialogs/file-open-location-dialog.c
	* app/dialogs/file-save-dialog.c
	* app/dialogs/palette-import-dialog.c
	* app/display/gimpdisplayshell-close.c
	* app/display/gimpdisplayshell-dnd.c
	* app/display/gimpdisplayshell-title.c
	* app/file/file-open.c
	* app/widgets/gimpdnd-xds.c
	* app/widgets/gimpfiledialog.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpthumbbox.c
	* app/widgets/gimptoolbox-dnd.c
	* app/widgets/gimptoolbox.c
	* app/widgets/gimpviewabledialog.c: use the new functions.

	* plug-ins/help/domain.c: use g_filename_display_name().
2005-10-01 22:43:22 +00:00
14b9312a72 app/widgets/gimpprogressbox.c made progress bars HIG compliant (with
2005-09-28  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpprogressbox.c
	* plug-ins/script-fu/script-fu-interface.c: made progress bars HIG
	compliant (with italic label below).

	* app/widgets/gimpfiledialog.[ch]: use a GimpProgressBox intead of
	implementing the progress bar again.
2005-09-28 21:20:05 +00:00
b10adabb5e Added parent window API to the GimpProgress interface and to the libgimp
2005-09-09  Michael Natterer  <mitch@gimp.org>

	Added parent window API to the GimpProgress interface and to
	the libgimp progress stuff. Might look strange, but does
	the right thing in almost all cases (image window, file dialog,
	script-fu dialog etc). Fixes bug #62988.

	* app/core/gimpprogress.[ch]: added GimpProgress::get_window()
	which should return a toplevel window ID if the progress is in a
	window that wants to be the transient parent of plug-in dialogs.

	* app/widgets/gimpwidgets-utils.[ch] (gimp_window_get_native): new
	function which returns the window handle of a GtkWindow's GdkWindow.

	* app/widgets/gimpfiledialog.c: implement ::get_window().

	* app/display/gimpdisplay.[ch]: ditto. Removed window handle API.

	* app/gui/gui-vtable.c: changed accordingly.

	* libgimpbase/gimpbaseenums.[ch] (enum GimpProgressCommand):
	added GIMP_PROGRESS_COMMAND_GET_WINDOW.

	* app/plug-in/plug-in-progress.[ch] (plug_in_progress_get_window):
	new function. Also renamed some functions to match the
	GimpProgress interface, and not the legacy PDB procedure names.

	* tools/pdbgen/pdb/progress.pdb
	* app/core/gimppdbprogress.c: implement get_window() on both
	sides of the wire, keeping backward compatibility (hopefully).

	* libgimp/gimpprogress.[ch]: deprecated gimp_progress_install()
	and added gimp_progress_install_vtable() which takes a vtable with
	padding to be extensible. Added get_window() vtable entry and
	dispatch it accordingly. Also added pulse() which was implemented
	in a hackish way before. Everything is of course backward
	compatible.

	* libgimp/gimpprogressbar.c: inmplement the get_window() stuff
	so a plug-in dialog containing a progress can be the transient
	parent of another dialog in another plug-in.

	* libgimp/gimpui.[ch] (gimp_ui_get_progress_window): new function
	which returns a foreign GdkWindow of this plug-ins progress
	window.

	Renamed gimp_window_set_transient_for_default_display() to
	gimp_window_set_transient() and make it use the progress' window
	handle instead of the display's (which is the right thing to do in
	almost all cases).

	* libgimp/gimp.def
	* libgimp/gimpui.def: add the new functions.

	* tools/pdbgen/enums.pl
	* app/pdb/internal_procs.c
	* app/pdb/progress_cmds.c
	* libgimp/gimpprogress_pdb.[ch]: regenerated.

	* libgimp/gimpexport.c
	* plug-ins/*/*.c: follow API change.
2005-09-09 18:07:31 +00:00
e7a14aaa71 applied capitalization patches contributed by Stephan Binner. Fixes bug
2005-08-23  Sven Neumann  <sven@gimp.org>

	* [lots of files]: applied capitalization patches contributed by
	Stephan Binner. Fixes bug #309657.
2005-08-23 00:18:08 +00:00
2cbf6ca5f4 when looking for the file extension, only look at the part after the last
2005-08-20  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_proc_changed):
	when looking for the file extension, only look at the part after
	the last directory separator.
2005-08-20 20:34:25 +00:00
4e9fd4f69f canonicalize hardcoded procedure names.
2005-08-03  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_new):
	canonicalize hardcoded procedure names.
2005-08-03 09:38:01 +00:00
c6ca1a8419 enable remote files: set local_only to FALSE if the PDB has
2005-07-08  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_new): enable
	remote files: set local_only to FALSE if the PDB has
	"file_uri_load/save" procedures (yes, this is questionable).
2005-07-08 18:27:24 +00:00
f6cb341c3c app/dialogs/file-save-dialog.c moved overwrite confirmation dialog to
2005-03-25  Sven Neumann  <sven@gimp.org>

	* app/dialogs/file-save-dialog.c
	* app/widgets/gimpfiledialog.[ch]: moved overwrite confirmation
	dialog to app/widgets.

	* app/widgets/gimpdnd-xds.c: set "Untitled.xcf" as default name
	for untitled images; ask for confirmation before overwriting a
	local file.
2005-03-25 20:18:55 +00:00
7c19953c39 added GimpProgress::pulse.
2005-02-12  Sven Neumann  <sven@gimp.org>

	* app/core/gimpprogress.[ch]: added GimpProgress::pulse.

	* app/display/gimpdisplay.c
	* app/display/gimpstatusbar.c
	* app/widgets/gimpfiledialog.c
	* app/widgets/gimpprogressbox.c
	* app/widgets/gimpprogressdialog.c
	* app/widgets/gimpthumbbox.c: implement it in the classes that
	implement the GimpProgress interface.

	* app/plug-in/plug-in-progress.[ch]: allow plug-ins to pulse their
	progress.

	* tools/pdbgen/pdb/progress.pdb: added a procedure for the new
	functionality.

	* app/pdb/internal_procs.c
	* app/pdb/progress_cmds.c
	* libgimp/gimpprogress_pdb.[ch]: regenerated.

	* libgimp/gimp.def: updated.
2005-02-12 14:18:12 +00:00
d4535cc31f add an "All Images" filter and select it by default.
2005-02-07  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_add_filters): add
	an "All Images" filter and select it by default.
2005-02-07 18:46:03 +00:00
747ffe8b6e ooops, didn't mean to commit that change 2005-02-07 17:31:40 +00:00
313f7835cb changed "Remote Image" to "Remote File". The state of the thumbnail
2005-02-07  Sven Neumann  <sven@gimp.org>

	* app/core/gimpimagefile.c (gimp_imagefile_get_desc_string):
	changed "Remote Image" to "Remote File". The state of the
	thumbnail doesn't tell us if this is an image file at all.

	* app/widgets/gimpthumbbox.c: don't auto-thumbnail remote files.

	* libgimpthumb/gimpthumb-utils.[ch]
	* libgimpthumb/gimpthumbnail.c: do the same workaround for UNC
	paths as in file_utils_filename_from_uri().
2005-02-07 17:29:10 +00:00
4f97f7a5f9 Made the file open and save dialogs use the last used folder instead of
2005-01-13  Michael Natterer  <mitch@gimp.org>

	Made the file open and save dialogs use the last used folder
	instead of defaulting to current directory. Fixes bug #162385.

	* app/widgets/gimpfiledialog.[ch] (gimp_file_dialog_set_uri):
	removed this function because it had no functionality except
	creating usability problems.

	* app/actions/file-commands.c: use gtk_file_chooser_set_uri()
	instead but *only* if we already have an uri from an alread open
	image or the document hinstory.

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_image): set
	the file chooser's uri only if we have an uri from the image
	itself. Leave the current folder untouched otherwise and just set
	the current name (e.g. "Untitled").

	* app/dialogs/file-save-dialog.c (file_save_dialog_save_image): on
	successful save, remember the used uri by attaching it to the
	"gimp" instance.

	(file_save_dialog_new): set the last saved uri's folder on the
	newly created file save dialog.
2005-01-13 17:41:48 +00:00
30164f1be2 added back the .xcf.gz and .xcf.bz2 extensions because they are the only
2004-11-18  Michael Natterer  <mitch@gimp.org>

	* plug-ins/common/compressor.c (compressors): added back the
	.xcf.gz and .xcf.bz2 extensions because they are the only way
	to figure the special nature of this plug-in's extensions.

	* app/widgets/gimpfileprocview.[ch]: keep a list of "meta
	extensions" (extensions which have a '.' themselves).

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_proc_changed):
	try to replace the whole extension if the last extension is one of
	the meta extensions kept by GimpFileProcView. Fixes bug #158377.
2004-11-18 11:50:25 +00:00
d4bf381c20 app/actions/file-commands.c app/dialogs/file-save-dialog.c
2004-11-16  Sven Neumann  <sven@gimp.org>

	* app/actions/file-commands.c
	* app/dialogs/file-save-dialog.c
	* app/file/file-save.[ch]
	* app/widgets/gimpfiledialog.[ch]: combined "set_uri_and_proc" and
	"set_image_clean" parameters into a single "save_a_copy"
	parameter.  When saving a copy, attach the used URI to the image and
	let the "Save a Copy" file chooser default to the last used value.
2004-11-16 13:37:36 +00:00
c286aece5d limit the number of file extensions that are added to the file filter menu
2004-11-15  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_add_filters):
	limit the number of file extensions that are added to the file
	filter menu to keep the file dialog from growing too wide.
2004-11-15 19:33:24 +00:00
562b1595f2 better fix for bug #158369.
2004-11-15  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_proc_changed):
	better fix for bug #158369.
2004-11-15 13:42:22 +00:00
e196a77246 return early if gimp_file_proc_view_get_proc() didn't return a file
2004-11-15  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_proc_changed):
	return early if gimp_file_proc_view_get_proc() didn't return a file
	procedure. Should fix bug #158369.
2004-11-15 13:38:00 +00:00
c70b12137b plugged a mem-leak.
2004-11-03  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_add_filters):
	plugged a mem-leak.

	* app/widgets/gimpviewrendererimagefile.c
	(gimp_view_renderer_imagefile_render): don't leak the pixbuf.

	* app/widgets/gimpviewrenderer-frame.c: added a comment.
2004-11-03 00:48:06 +00:00
caac418cb2 don't check for file_proc->menu_paths. Our load and save procedure don't
2004-11-01  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_add_filters):
	don't check for file_proc->menu_paths. Our load and save procedure
	don't necessarily register a menu path any longer.

	* app/plug-in/plug-ins.c: minor cleanup.

	* app/xcf/xcf.c (xcf_init): no need for adding menu paths for the
	XCF load and save procedures.

	* tools/pdbgen/pdb/fileops.pdb: fixed outdated documentation.

	* app/pdb/fileops_cmds.c
	* libgimp/gimpfileops_pdb.c: regenerated.
2004-11-01 15:44:57 +00:00
5460383b57 construct a case-insensitive glob pattern to use when filtering for file
2004-10-11  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c: construct a case-insensitive glob
	pattern to use when filtering for file extensions.
2004-10-11 11:57:32 +00:00
94b427de98 added a help button.
2004-10-05  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c: added a help button.
2004-10-04 22:25:04 +00:00
9ffc00be80 app/plug-in/Makefile.am removed... ...and added with a new name.
2004-09-22  Michael Natterer  <mitch@gimp.org>

	* app/plug-in/Makefile.am
	* app/plug-in/plug-in-proc.[ch]: removed...
	* app/plug-in/plug-in-proc-def.[ch]: ...and added with a new name.

	* app/plug-in/plug-in-def.[ch]
	* app/plug-in/plug-in-message.[ch]
	* app/plug-in/plug-in-progress.[ch]
	* app/plug-in/plug-in-rc.[ch]
	* app/plug-in/plug-in-run.[ch]
	* app/plug-in/plug-in.[ch]
	* app/plug-in/plug-ins.[ch]
	* app/actions/plug-in-actions.c
	* app/actions/plug-in-commands.c
	* app/file/file-open.[ch]
	* app/file/file-save.[ch]
	* app/file/file-utils.[ch]
	* app/gui/gui-vtable.c
	* app/menus/plug-in-menus.c
	* app/widgets/gimpfiledialog.c
	* app/widgets/gimpfileprocview.c
	* app/widgets/gimppluginaction.c
	* app/xcf/xcf.c
	* tools/pdbgen/pdb/fileops.pdb
	* tools/pdbgen/pdb/plug_in.pdb: changed accordingly plus some
	minor cosmetic cleanups.

	* app/pdb/fileops_cmds.c
	* app/pdb/plug_in_cmds.c: regenerated.
2004-09-22 15:12:24 +00:00
d8a3c0c08c simplified the code that selects an image file by its URI.
2004-09-07  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_uri):
	simplified the code that selects an image file by its URI.
2004-09-07 10:45:36 +00:00
4bfbd2c5c3 bumped version number to 2.1.5.
2004-09-05  Sven Neumann  <sven@gimp.org>

	* configure.in: bumped version number to 2.1.5.

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_uri): select
	the image file, not only the folder it lives in. Fixes bug #151638.
2004-09-05 20:17:53 +00:00
1622243213 app/widgets/gimppreviewrenderer-utils.c
* app/widgets/gimppreviewrenderer-utils.c
* app/widgets/gimppreviewrenderer-utils.h
* app/widgets/gimppreviewrendererbrush.c
* app/widgets/gimppreviewrendererbrush.h
* app/widgets/gimppreviewrendererdrawable.c
* app/widgets/gimppreviewrendererdrawable.h
* app/widgets/gimppreviewrenderergradient.c
* app/widgets/gimppreviewrenderergradient.h
* app/widgets/gimppreviewrendererimage.c
* app/widgets/gimppreviewrendererimage.h
* app/widgets/gimppreviewrendererimagefile.c
* app/widgets/gimppreviewrendererimagefile.h
* app/widgets/gimppreviewrendererlayer.c
* app/widgets/gimppreviewrendererlayer.h
* app/widgets/gimppreviewrenderervectors.c
* app/widgets/gimppreviewrenderervectors.h: Renamed all these files...

* app/widgets/gimpviewrenderer-utils.c
* app/widgets/gimpviewrenderer-utils.h
* app/widgets/gimpviewrendererbrush.c
* app/widgets/gimpviewrendererbrush.h
* app/widgets/gimpviewrendererdrawable.c
* app/widgets/gimpviewrendererdrawable.h
* app/widgets/gimpviewrenderergradient.c
* app/widgets/gimpviewrenderergradient.h
* app/widgets/gimpviewrendererimage.c
* app/widgets/gimpviewrendererimage.h
* app/widgets/gimpviewrendererimagefile.c
* app/widgets/gimpviewrendererimagefile.h
* app/widgets/gimpviewrendererlayer.c
* app/widgets/gimpviewrendererlayer.h
* app/widgets/gimpviewrenderervectors.c
* app/widgets/gimpviewrenderervectors.h: ... to these names. And also
  changed all the GimpPreviewRenderer* types to GimpViewRenderer* ones.

* app/tools/gimppaintoptions-gui.c

* app/widgets/Makefile.am
* app/widgets/gimpcomponenteditor.c
* app/widgets/gimpfiledialog.c
* app/widgets/gimpgradienteditor.c
* app/widgets/gimpview.c
* app/widgets/widgets-types.h
* app/widgets/gimpviewrenderer.c
* app/widgets/gimpviewrenderer.h: modified accordingly.
2004-08-26 14:20:30 +00:00
cddf61a3e6 app/widgets/gimppreview.c renamed these two files to...
* app/widgets/gimppreview.c
* app/widgets/gimppreview.h: renamed these two files to...

* app/widgets/gimpview.c
* app/widgets/gimpview.h: ... these files.

Also renamed GimpPreview to GimpView.
This is the first step of the great Preview->View renaming process.

* app/actions/palettes-commands.c

* app/display/gimpdisplayshell-layer-select.c
* app/display/gimpnavigationview.c

* app/gui/palette-import-dialog.c

* app/tools/gimppaintoptions-gui.c

* app/widgets/Makefile.am
* app/widgets/gimpaction.c
* app/widgets/gimpactiongroup.c
* app/widgets/gimpbrusheditor.c
* app/widgets/gimpbufferview.c
* app/widgets/gimpcontainerbox.c
* app/widgets/gimpcontainergridview.c
* app/widgets/gimpcontainergridview.h
* app/widgets/gimpdevicestatus.c
* app/widgets/gimpdnd.c
* app/widgets/gimpdockbook.c
* app/widgets/gimpfiledialog.c
* app/widgets/gimpgradienteditor.c
* app/widgets/gimpnavigationpreview.c
* app/widgets/gimpnavigationpreview.h
* app/widgets/gimppaletteeditor.c
* app/widgets/gimppreview-popup.c
* app/widgets/gimppropwidgets.c
* app/widgets/gimpselectioneditor.c
* app/widgets/gimpthumbbox.c
* app/widgets/gimptoolbox-image-area.c
* app/widgets/gimptoolbox-indicator-area.c
* app/widgets/gimptooloptionseditor.c
* app/widgets/gimpviewabledialog.c
* app/widgets/widgets-types.h: changed accordingly.
2004-08-24 17:16:46 +00:00
509b48a48b unset the filename if gtk_file_chooser_set_uri() failed.
2004-08-23  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_image): unset
	the filename if gtk_file_chooser_set_uri() failed.

	* app/actions/file-commands.c
	* app/gui/file-save-dialog.c: trivial cleanups.

	* app/widgets/gimpwidgets-utils.c: removed an unused extern
	variable declaration.
2004-08-23 09:32:06 +00:00
57a3396d40 added virtual function gboolean GimpProgressInterface::is_active().
2004-08-11  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpprogress.[ch]: added virtual function
	gboolean GimpProgressInterface::is_active().

	* app/display/gimpdisplay.c
	* app/display/gimpstatusbar.c
	* app/widgets/gimpfiledialog.c
	* app/widgets/gimpprogressbox.c
	* app/widgets/gimpprogressdialog.c
	* app/widgets/gimpthumbbox.c: implement it.

	* app/plug-in/plug-in.h: removed "gboolean progress_active" and
	added "gulong progress_cancel_id" instead.

	* app/plug-in/plug-in-progress.c: changed accordingly. Make sure
	we correctly handle the "cancel" connections of progress instances
	passed from other plug-ins.
2004-08-11 10:29:56 +00:00
06ea7dbd96 app/widgets/Makefile.am app/widgets/widgets-types.h new GtkVBox subclass
2004-08-11  Michael Natterer  <mitch@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpprogressbox.[ch]: new GtkVBox subclass featuring
	a label and a progressbar. Implements GimpProgressIterface.

	* app/widgets/gimpprogressdialog.[ch]: replaced label and progress
	by a GimpProgressBox. Delegate most progress functionality to it.

	* app/widgets/gimpwidgets-utils.[ch]: factored out utility
	function gimp_dialog_set_sensitive().

	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_sensitive):
	use it.

	* app/gui/file-open-location-dialog.c (file_open_location_response):
	embed the called file procedure's progress using a GimpProgressBox.
2004-08-10 22:21:56 +00:00
95607cce19 new function which works on all widgets in the dialog except the cancel
2004-08-10  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpfiledialog.[ch]
	(gimp_file_dialog_set_sensitive): new function which works on all
	widgets in the dialog except the cancel button.

	Remember if the active progress is cancelable and added two
	booleans "busy" and "canceled". Added GtkDialog::response()
	implementation which, if the dialog is busy, cancels the active
	progress and sets the dialog's "canceled" state.

	Moved the progress bar right above the action area so it is next
	to the cancel button and in the same place for both open and save
	dialogs.

	* app/gui/file-open-dialog.c
	* app/gui/file-save-dialog.c: use the new API to make image loading
	and saving cancelable again.

	* app/widgets/gimpthumbbox.c: use the same stuff to make
	thumbnailing cancelable. Increased the minimum height a bit so it
	doesn't resize when the progress bars are shown.
2004-08-10 21:20:38 +00:00