Commit Graph

210 Commits

Author SHA1 Message Date
017278c111 app/dialogs/file-open-dialog.c app/display/gimpdisplayshell-dnd.c
2006-03-03  Sven Neumann  <sven@gimp.org>

	* tools/pdbgen/pdb/fileops.pdb:
	* app/dialogs/file-open-dialog.c
	* app/display/gimpdisplayshell-dnd.c
	* app/file/file-open.[ch]
	* app/widgets/gimplayertreeview.c: pass the selected load procedure
	to file_open_layer() or NULL if none is selected. Fixes bug #333207.

	* app/pdb/fileops_cmds.c: regenerated.
2006-03-03 19:51:20 +00:00
5236dc6f13 app/actions/dockable-actions.c app/actions/dockable-commands.[ch]
2006-01-17  Michael Natterer  <mitch@gimp.org>

	* app/actions/dockable-actions.c
	* app/actions/dockable-commands.[ch]
	* app/dialogs/dialogs-constructors.[ch]
	* app/dialogs/dialogs.c
	* app/display/gimpdisplayshell-layer-select.c
	* app/widgets/gimpbrusheditor.[ch]
	* app/widgets/gimpbrushfactoryview.h
	* app/widgets/gimpbufferview.[ch]
	* app/widgets/gimpchanneltreeview.c
	* app/widgets/gimpcomponenteditor.[ch]
	* app/widgets/gimpcontainerbox.c
	* app/widgets/gimpcontainercombobox.[ch]
	* app/widgets/gimpcontainereditor.[ch]
	* app/widgets/gimpcontainerentry.[ch]
	* app/widgets/gimpcontainergridview.[ch]
	* app/widgets/gimpcontainerpopup.[ch]
	* app/widgets/gimpcontainertreeview.[ch]
	* app/widgets/gimpcontainerview.[ch]
	* app/widgets/gimpdatafactoryview.[ch]
	* app/widgets/gimpdevicestatus.c
	* app/widgets/gimpdialogfactory.[ch]
	* app/widgets/gimpdocumentview.[ch]
	* app/widgets/gimpfontview.[ch]
	* app/widgets/gimpgradienteditor.[ch]
	* app/widgets/gimpimageview.[ch]
	* app/widgets/gimpitemtreeview.[ch]
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpmenudock.c
	* app/widgets/gimppatternfactoryview.[ch]
	* app/widgets/gimppropwidgets.[ch]
	* app/widgets/gimpselectioneditor.[ch]
	* app/widgets/gimpsessioninfo.[ch]
	* app/widgets/gimptemplateview.[ch]
	* app/widgets/gimptooloptionseditor.c
	* app/widgets/gimptoolview.[ch]
	* app/widgets/gimpundoeditor.[ch]
	* app/widgets/gimpviewablebox.c
	* app/widgets/gimpviewablebutton.[ch]
	* app/widgets/gimpviewabledialog.[ch]
	* app/widgets/gimpviewrenderer.c: change the word "preview" to
	"view" whereever we talk about GimpView or GimpViewRenderer
	objects or their sizes. Ther were renamed from "Preview" a long
	time ago and we had a preview/view naming mess ever since.
2006-01-17 10:08:50 +00:00
61df53ec54 port to G_DEFINE_TYPE() and friends. Some related cleanup.
2005-12-19  Michael Natterer  <mitch@gimp.org>

	* app/widgets/*.c: port to G_DEFINE_TYPE() and friends. Some
	related cleanup.
2005-12-19 22:37:49 +00:00
6912227651 added run-mode parameter to file_open_layer().
2005-10-17  Sven Neumann  <sven@gimp.org>

	* app/file/file-open.[ch]: added run-mode parameter to
	file_open_layer().

	* app/dialogs/file-open-dialog.c
	* app/display/gimpdisplayshell-dnd.c
	* app/widgets/gimplayertreeview.c: pass GIMP_RUN_INTERACTIVE to
	file_open_layer().

	* tools/pdbgen/pdb/fileops.pdb: export file_open_layer() to the PDB
	as file-load-layer.

	* app/pdb/fileops_cmds.c
	* app/pdb/internal_procs.c
	* libgimp/gimpfileops_pdb.[ch]: regenerated.

	* libgimp/gimp.def: updated.
2005-10-17 15:15:20 +00:00
ee64ca3c90 introduced variants of file_utils_uri_to_utf8_filename() and
2005-10-02  Sven Neumann  <sven@gimp.org>

	* app/file/file-utils.[ch]: introduced variants of
	file_utils_uri_to_utf8_filename() and
	file_utils_uri_to_utf8_basename() that use g_filename_display_name()
	and g_filename_display_basename().

	* app/actions/data-commands.c
	* app/actions/documents-commands.c
	* app/actions/file-actions.c
	* app/actions/file-commands.c
	* app/core/gimpimage.c
	* app/core/gimpimagefile.c
	* app/dialogs/file-open-dialog.c
	* app/dialogs/file-open-location-dialog.c
	* app/dialogs/file-save-dialog.c
	* app/dialogs/palette-import-dialog.c
	* app/display/gimpdisplayshell-close.c
	* app/display/gimpdisplayshell-dnd.c
	* app/display/gimpdisplayshell-title.c
	* app/file/file-open.c
	* app/widgets/gimpdnd-xds.c
	* app/widgets/gimpfiledialog.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpthumbbox.c
	* app/widgets/gimptoolbox-dnd.c
	* app/widgets/gimptoolbox.c
	* app/widgets/gimpviewabledialog.c: use the new functions.

	* plug-ins/help/domain.c: use g_filename_display_name().
2005-10-01 22:43:22 +00:00
805602b657 if the floating selection has no alpha, manually create BoundSegs of its
2005-09-08  Michael Natterer  <mitch@gimp.org>

	* app/core/gimplayer-floating-sel.c (floating_sel_boundary): if
	the floating selection has no alpha, manually create BoundSegs of
	its outline instead of calling boundary_find() (which creates a
	boundary of the last channel). Fixes bug #145373.

	* app/widgets/gimplayertreeview.c
	(gimp_layer_tree_view_floating_selection_changed): update all
	layer names' text attributes, not only for layers with alpha.
	Fixes layer name display when making a new layer out of a floating
	selection without alpha.
2005-09-08 19:38:58 +00:00
32d875d070 app/dialogs/module-dialog.c app/dialogs/palette-import-dialog.c
2005-08-03  Michael Natterer  <mitch@gimp.org>

	* app/dialogs/module-dialog.c
	* app/dialogs/palette-import-dialog.c
	* app/gui/gui.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimpimagemaptool.c
	* app/tools/gimplevelstool.c
	* app/tools/gimpvectortool.c
	* app/widgets/gimpaction.c
	* app/widgets/gimpcoloreditor.c
	* app/widgets/gimpcontainerbox.c
	* app/widgets/gimpcontainertreeview.c
	* app/widgets/gimpcursorview.c
	* app/widgets/gimpdnd.c
	* app/widgets/gimpdock.c
	* app/widgets/gimpdockbook.c
	* app/widgets/gimpdrawabletreeview.c
	* app/widgets/gimpeditor.c
	* app/widgets/gimpenumaction.c
	* app/widgets/gimperrordialog.c
	* app/widgets/gimpfileprocview.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpmenudock.c
	* app/widgets/gimpmessagebox.c
	* app/widgets/gimpmessagedialog.c
	* app/widgets/gimppluginaction.c
	* app/widgets/gimpprogressdialog.c
	* app/widgets/gimpsamplepointeditor.c
	* app/widgets/gimpstringaction.c
	* app/widgets/gimptemplateeditor.c
	* app/widgets/gimptoolbox-image-area.c
	* app/widgets/gimptoolbox.c: use canonical names for signals and
	properties.
2005-08-03 09:34:55 +00:00
e1be822e3d moved the lock alpha toggle to a separate "Lock:" line.
2005-07-10  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimplayertreeview.c (gimp_layer_tree_view_init):
	moved the lock alpha toggle to a separate "Lock:" line.
2005-07-10 21:24:21 +00:00
20b4769cf5 app/actions/layers-actions.c app/actions/layers-commands.[ch]
2005-07-10  Michael Natterer  <mitch@gimp.org>

	* app/actions/layers-actions.c
	* app/actions/layers-commands.[ch]
	* app/core/core-enums.[ch]
	* app/core/gimpimage-undo-push.[ch]
	* app/core/gimplayer-floating-sel.c
	* app/core/gimplayer.[ch]
	* app/text/gimptextlayer-xcf.c
	* app/widgets/gimphelp-ids.h
	* app/widgets/gimplayertreeview.[ch]
	* app/xcf/xcf-load.c
	* app/xcf/xcf-private.h
	* app/xcf/xcf-save.c
	* tools/pdbgen/pdb/layer.pdb
	* menus/image-menu.xml.in
	* libgimp/gimp.def: did a global s/preserve_trans/lock_alpha/ in
	preparation for more layer locking flags.

	* app/pdb/procedural_db.c
	* libgimp/gimplayer.[ch]: added compat stuff for preserve_trans.

	* app/pdb/layer_cmds.c
	* libgimp/gimplayer_pdb.[ch]: regenerated.

	* plug-ins/common/colortoalpha.c
	* plug-ins/common/iwarp.c
	* plug-ins/common/psd.c
	* plug-ins/common/psd_save.c
	* plug-ins/common/psp.c
	* plug-ins/common/rotate.c
	* plug-ins/common/threshold_alpha.c
	* plug-ins/common/vpropagate.c
	* plug-ins/script-fu/scripts/3d-outline.scm
	* plug-ins/script-fu/scripts/alien-glow-bar.scm
	* plug-ins/script-fu/scripts/alien-glow-bullet.scm
	* plug-ins/script-fu/scripts/alien-glow-logo.scm
	* plug-ins/script-fu/scripts/basic1-logo.scm
	* plug-ins/script-fu/scripts/basic2-logo.scm
	* plug-ins/script-fu/scripts/beveled-pattern-button.scm
	* plug-ins/script-fu/scripts/blend-anim.scm
	* plug-ins/script-fu/scripts/blended-logo.scm
	* plug-ins/script-fu/scripts/bovinated-logo.scm
	* plug-ins/script-fu/scripts/burn-in-anim.scm
	* plug-ins/script-fu/scripts/carved-logo.scm
	* plug-ins/script-fu/scripts/chalk.scm
	* plug-ins/script-fu/scripts/chip-away.scm
	* plug-ins/script-fu/scripts/comic-logo.scm
	* plug-ins/script-fu/scripts/coolmetal-logo.scm
	* plug-ins/script-fu/scripts/crystal-logo.scm
	* plug-ins/script-fu/scripts/drop-shadow.scm
	* plug-ins/script-fu/scripts/gimp-headers.scm
	* plug-ins/script-fu/scripts/gimp-labels.scm
	* plug-ins/script-fu/scripts/glowing-logo.scm
	* plug-ins/script-fu/scripts/gradient-bevel-logo.scm
	* plug-ins/script-fu/scripts/image-structure.scm
	* plug-ins/script-fu/scripts/neon-logo.scm
	* plug-ins/script-fu/scripts/perspective-shadow.scm
	* plug-ins/script-fu/scripts/starburst-logo.scm
	* plug-ins/script-fu/scripts/starscape-logo.scm
	* plug-ins/script-fu/scripts/textured-logo.scm
	* plug-ins/script-fu/scripts/title-header.scm
	* plug-ins/script-fu/scripts/waves-anim.scm
	* plug-ins/xjt/xjt.c: changed accordingly.
2005-07-10 21:17:22 +00:00
7123168f22 there's no need to keep a reference to the anchor button.
2005-06-15  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimplayertreeview.[ch]: there's no need to keep a
	reference to the anchor button.
2005-06-15 14:52:01 +00:00
93eab43eef Use the canonical form for signal names.
2005-05-27  Sven Neumann  <sven@gimp.org>

	* (lots of files): Use the canonical form for signal names.
2005-05-27 16:51:39 +00:00
2a08c79b2b app/actions/layers-actions.c app/core/gimpimage.c
2005-05-06  Sven Neumann  <sven@gimp.org>

	* app/actions/layers-actions.c
	* app/core/gimpimage.c (gimp_image_position_layer)
	* app/widgets/gimplayertreeview.c (gimp_layer_tree_view_drop_possible):
	drop the limitation that layers not at the bottom of the stack
	have to have an alpha channel. Allow the user to move the
	background layer up in the stack or reposition it using DND.

	* tips/gimp-tips.xml.in: changed the relevant tip and some more.
2005-05-06 20:45:21 +00:00
7609645970 Implement dragging and dropping in any GdkPixbuf supported format. Fixes
2005-04-09  Michael Natterer  <mitch@gimp.org>

	Implement dragging and dropping in any GdkPixbuf supported
	format. Fixes bug #172794 and bug #172795.

	* app/core/gimplayer.[ch] (gimp_layer_new_from_region): new
	function which contains all stuff that was in
	gimp_layer_new_from_tiles().

	(gimp_layer_new_from_tiles): use above function.
	(gimp_layer_new_from_pixbuf): new function.

	* app/widgets/Makefile.am
	* app/widgets/gimppixbuf.[ch]: new files containing GdkPixbuf
	utility functions for clipboard and DnD.

	* app/widgets/gimpselectiondata.[ch]: removed
	gimp_selection_data_set,get_pixbuf(), GTK+ provides the same API.
	Also removed GdkAtom parameters all over the place because it's
	always the same as selection_data->target.

	* app/widgets/gimpclipboard.c: use the new pixbuf utility
	functions and gtk_selection_data_set,get_pixbuf().

	* app/widgets/widgets-enums.h
	* app/widgets/gimpdnd.[ch]: removed never-implemented
	GIMP_DND_TYPE_PNG and added a generic GIMP_DND_TYPE_PIXBUF
	instead. Added API to drag and drop GdkPixbufs which transparently
	converts from/to and GdkPixbuf-supported image format. Removed
	passing around of GdkAtoms, since they were always the same
	as selection_data->target.

	* app/widgets/gimpdnd-xds.[ch]: follow GdkAtom parameter removal.

	* app/widgets/gimpcontainertreeview.[ch]: added virtual function
	GimpContainerTreeView::drop_pixbuf().

	* app/widgets/gimpcontainertreeview-dnd.c: dispatch drop_pixbuf().

	* app/widgets/gimplayertreeview.c: implement drop_pixbuf().

	* app/widgets/gimpdrawabletreeview.c: allow to drag all drawables
	as pixbufs.

	* app/display/gimpdisplayshell-dnd.c: allow dropping of pixbufs.
2005-04-09 17:56:04 +00:00
b8cf0e436f make "preview-size" and "preview-border-width" construct properties. Fixes
2005-03-18  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcontainerview.c: make "preview-size" and
	"preview-border-width" construct properties. Fixes creation
	using g_object_new().

	* app/widgets/gimpcontainerentry.c
	* app/widgets/gimpcontainertreeview.c
	* app/widgets/gimplayertreeview.c (set_preview_size): handle
	unset model and/or view gracefully.

	* app/dialogs/image-new-dialog.c: unset "focus-on-click" on the
	template combo-box.
2005-03-18 00:31:29 +00:00
86b62f7e1c undeprecated the paint mode menu (ported to GimpEnumComboBox with
2005-02-08  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpwidgets-constructors.[ch]: undeprecated the
	paint mode menu (ported to GimpEnumComboBox with separators).
	The separator code is quite hackish and therefore still
	implemented privately here.

	* app/widgets/gimpbrushselect.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimppropwidgets.c: changed accordingly.
2005-02-08 20:07:08 +00:00
0429d04908 Allow to drop stuff onto empty layers, channels and paths dialogs to
2005-01-17  Michael Natterer  <mitch@gimp.org>

	Allow to drop stuff onto empty layers, channels and paths dialogs
	to create new items:

	* app/widgets/gimpcontainertreeview.h (struct GimpContainerTreeView):
	added "gboolean dnd_drop_to_empty".

	* app/widgets/gimpcontainertreeview-dnd.c: if "dnd_drop_to_empty"
	is TRUE, dispatch drops to empty views and to the empty area below
	all items.

	* app/widgets/gimpitemtreeview.c (gimp_item_tree_view_init): set
	"dnd_drop_to_empty" to TRUE.

	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimpchanneltreeview.c
	* app/widgets/gimpdrawabletreeview.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpvectorstreeview.c: made all drop functions work
	with "dest_viewable" being NULL and changed drop_possible()
	implementations accordingly. Cleaned up the whole DND code a bit.

	* app/widgets/gimplayertreeview.c: removed color and pattern
	drop code...

	* app/widgets/gimpdrawabletreeview.c: and added it here so colors
	and patterns can be dropped to the channels dialog too.
2005-01-17 15:28:08 +00:00
e5c0d8eb0e app/core/gimpitem.c app/core/gimpdrawable.c made GimpItem::scale() and
2005-01-15  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpitem.c
	* app/core/gimpdrawable.c
	* app/vectors/gimpvectors.c: made GimpItem::scale() and ::resize()
	work on unattached items.

	* app/widgets/gimplayertreeview.c
	(gimp_layer_tree_view_drop_component): fix drop index.

	* app/widgets/gimpchanneltreeview.c: implement dropping of
	components as new channels. Fixes bug #158483.
2005-01-15 19:17:11 +00:00
63c933aef7 added virtual function GimpContainerTreeView::drop_component(). Added EEKy
2005-01-15  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainertreeview.[ch]: added virtual function
	GimpContainerTreeView::drop_component(). Added EEKy "dnd_gimp"
	needed for gimp_selection_data_get_component().

	* app/widgets/gimpitemtreeview.c (gimp_item_tree_view_set_context):
	set the "dnd_gimp" pointer if it is NULL.

	* app/widgets/gimpcontainertreeview-dnd.c: handle component drops
	and dispatch ::drop_component() accordingly.

	* app/widgets/gimplayertreeview.c: implement dropping of
	components as new layers. Addresses bugs #158483 and #158133.
2005-01-15 17:57:32 +00:00
bb3a6002cf handle drops of items of all types from all images and convert them if
2005-01-15  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpitemtreeview.c
	(gimp_item_tree_view_drop_viewable): handle drops of items of all
	types from all images and convert them if needed.

	* app/widgets/gimplayertreeview.c: enable dropping of all kinds of
	drawables. Addresses bug #158133.
2005-01-15 03:24:42 +00:00
b13aded024 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/actions/documents-commands.c
	* app/actions/file-commands.c
	* app/dialogs/file-open-dialog.c
	* app/dialogs/file-open-location-dialog.c
	* app/display/gimpdisplayshell-dnd.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimptoolbox-dnd.c: undo changes of 12-24,
	in favor of a better fix.

	* app/widgets/gimperrordialog.c: fix bug #162147 properly,
	as suggested by mitch.
2004-12-26 17:11:31 +00:00
59e86d02fb Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/actions/documents-commands.c
	* app/actions/file-commands.c
	* app/dialogs/file-open-dialog.c
	* app/dialogs/file-open-location-dialog.c
	* app/display/gimpdisplayshell-dnd.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimptoolbox-dnd.c: replace % with space
	in file name before showing error message,
	fixes bug #162147.

	* app/core/gimp-gui.c
	* app/widgets/gimpmessagebox.c: be a bit more paranoid
	about validating utf8 for messages.
2004-12-24 19:11:30 +00:00
fd6d30fd30 When there are variants of actions with and without dialog, let the
2004-10-23  Michael Natterer  <mitch@gimp.org>

	When there are variants of actions with and without dialog, let
	the dialog-less actions try to use the values from the last dialog
	invocation:

	* app/actions/channels-actions.c
	* app/actions/channels-commands.[ch]
	* app/actions/layers-actions.c
	* app/actions/layers-commands.[ch]
	* app/actions/vectors-actions.c
	* app/actions/vectors-commands.[ch]: renamed the foo-new-defaults
	actions to foo-new-last-values and use the last values entered in
	the dialogs.

	* app/widgets/gimpchanneltreeview.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpvectorstreeview.c: changed accordingly. Show
	the dialog on clicking "New" and call the last-values action on
	<shift>+click.

	* app/actions/select-actions.c
	* app/actions/vectors-commands.c: renamed the foo-stroke-last-vals
	to -last-values.

	* app/widgets/gimpselectioneditor.c
	* app/widgets/gimpvectorstreeview.c: stroke with last values on
	<shift> clicking the stroke buttons.
2004-10-23 00:53:48 +00:00
c84475c989 moved "item_type" and "signal_name" from GimpItemTreeView to
2004-10-16  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpitemtreeview.[ch]: moved "item_type" and
	"signal_name" from GimpItemTreeView to GimpItemTreeViewClass.
	Removed them from gimp_item_tree_view_new(). Require the view_type
	instead of item_type in gimp_item_tree_view_new().

	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimpdrawabletreeview.c (get_type): made them
	abstract base classes.

	* app/widgets/gimpchanneltreeview.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpvectorstreeview.c (class_init): set the
	item_type and signal_name members if GimpItemTreeViewClass.

	* app/dialogs/dialogs-constructors.c: changed accordingly.
2004-10-16 20:17:30 +00:00
f4d7260c64 app/actions/channels-actions.c app/actions/colormap-editor-actions.c
2004-10-16  Michael Natterer  <mitch@gimp.org>

	* app/actions/channels-actions.c
	* app/actions/colormap-editor-actions.c
	* app/actions/documents-actions.c
	* app/actions/tool-options-actions.c
	* app/actions/vectors-actions.c: added more tooltips for actions
	which are used as extended dialog button callbacks.

	* app/widgets/gimpeditor.c (gimp_editor_add_action_button): keep
	the list of extended actions in reverse order.

	* app/widgets/gimpchanneltreeview.c
	* app/widgets/gimpcolormapeditor.c
	* app/widgets/gimpdocumentview.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpselectioneditor.c
	* app/widgets/gimptooloptionseditor.c
	* app/widgets/gimpvectorstreeview.c: don't set the tooltips
	manually. Removes another bunch of insane translatable multiline
	format strings. Pass the extended actions in the right order
	to gimp_editor_add_action_button().
2004-10-16 17:10:04 +00:00
8effb0cfaf Ported the layers, channels and paths dialogs from
2004-10-16  Michael Natterer  <mitch@gimp.org>

	Ported the layers, channels and paths dialogs from
	gimp_editor_add_button() to gimp_editor_add_action_button(),
	removing a massive amount of duplicated code, sensitivity logic
	and confusing utility functions.

	* app/actions/channels-actions.c
	* app/actions/channels-commands.[ch]
	* app/actions/layers-actions.c
	* app/actions/layers-commands.[ch]
	* app/actions/vectors-actions.c
	* app/actions/vectors-commands.[ch]: added "foo-new-default"
	actions and callbacks which create items without a dialog,
	optionally using default values from a passed template. Removed
	all public utility function that were passed as function pointers
	to widget construtors. Added tooltips to all actions which are now
	used for dialog buttons.

	* app/widgets/gimpeditor.c (gimp_editor_add_action_button):
	automatically create multi-line tooltips showing the modifiers for
	extended action buttons. Removes the need for lots of insane
	format strings that need to be translated correctly.

	* app/widgets/gimpitemtreeview.[ch] (struct GimpItemTreeViewClass):
	replaced tooltip and help_id strings by action names.

	(struct GimpItemTreeView)
	(gimp_item_tree_view_new): removed "edit", "new" and "activate"
	function pointers.

	(gimp_item_tree_view_constructor): create all buttons
	with gimp_editor_add_action_button(), using the action names
	from GimpItemTreeViewClass.

	Removed tons of "clicked" callbacks and all code which sets the
	buttons' sensitivity. They are not needed any longer.

	Require all subclasses to implement GimpItemTreeView::new_item(),
	a new virtual function which creates a plain new item without
	showing a dialog.

	* app/widgets/gimpdrawabletreeview.c
	* app/widgets/gimpchanneltreeview.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpvectorstreeview.c: fill in the action names and
	implement GimpItemTreeView::new_item(). Removed all button
	sensitivity logic.

	* app/dialogs/dialogs-constructors.c: changed accordingly. Doesn't
	include anything from actions/ any more.
2004-10-16 15:48:23 +00:00
10d80dac75 removed the hack that was displaying "Floating Selection" instead of the
2004-09-22  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimplayertreeview.c
	(gimp_layer_tree_view_floating_selection_changed): removed the
	hack that was displaying "Floating Selection" instead of the
	floating layer's real name.

	* app/core/gimplayer.c: implement GimpViewable::get_description()
	instead and special case floating selections with a two-line
	text that contains "Floating Selection".

	* app/core/gimplayer-floating-sel.c
	* app/core/gimpimage-undo-push.c: emit "name_changed" on the layer
	when it changes its state from floating to normal or vice versa
	so the views can update accordingly.

	* app/core/gimpselection.c: s/"Selection"/"Floated Layer"/.

	* app/tools/gimpeditselectiontool.c:
	s/"Floating Layer"/"Floating Selection"/.
2004-09-22 12:46:35 +00:00
c3ef897b10 Try to make floating selections more obvious:
2004-09-19  Sven Neumann  <sven@gimp.org>

	Try to make floating selections more obvious:

	* app/widgets/gimplayertreeview.c
	(gimp_layer_tree_view_floating_selection_changed): always display
	"Floating Selection" as the name for a floating selection.

	* app/core/gimpselection.c (gimp_selection_float): call the new
	layer "Selection" instead of "Floating Selection". This is what
	will be displayed if the FS is turned into a layer.

	* app/actions/layers-commands.c (layers_edit_layer_query): don't
	special case floating selections here.

	* app/core/gimplayer-floating-sel.c: cosmetics.
2004-09-19 16:56:03 +00:00
6a723efc4b app/actions/layers-actions.c added actions and callbacks
2004-09-15  Michael Natterer  <mitch@gimp.org>

	* app/actions/layers-actions.c
	* app/actions/layers-commands.[ch]: added actions and callbacks
	"layers-preserve-transparency" and
	"layers-paint-mode-first,last,previous,next". Update the "active"
	state of the recently added layer mask property actions in
	layers_actions_update().

	* app/actions/drawable-actions.c
	* app/actions/drawable-commands.[ch]: added actions and callbacks
	for "drawable-visible" and "drawable-linked". Fixes bug #152597.

	* app/actions/vectors-actions.c
	* app/actions/vectors-commands.[ch]: same here ("vectors-visible"
	and "vectors-linked").

	* app/widgets/gimplayertreeview.c
	(gimp_layer_tree_view_preserve_button_toggled): flush the image
	so the new actions are updated. Compress preserve_trans undos.

	* menus/image-menu.xml.in: added the layer mask property actions
	to the Layers/Mask submenu.

	* menus/layers-menu.xml: reordered the mask property actions
	to have the same order as in the image menu.
2004-09-15 13:24:45 +00:00
e91187ae86 app/widgets/gimppreview-popup.c renamed these files...
* app/widgets/gimppreview-popup.c
* app/widgets/gimppreview-popup.h: renamed these files...

* app/widgets/gimpview-popup.c
* app/widgets/gimpview-popup.h: .. to these files, and changed the
  GimpPreviewPopup type to GimpViewPopup.

* app/widgets/gimppreviewrenderer.c
* app/widgets/gimppreviewrenderer.h: renamed these files...

* app/widgets/gimpviewrenderer.c
* app/widgets/gimpviewrenderer.h: .. to these files, and changed
  GimpPreviewRenderer to GimpViewRenderer.

This is the second step of the great Preview->View renaming process.

* app/display/gimpdisplayshell-layer-select.c
* app/display/gimpnavigationeditor.c

* app/widgets/Makefile.am
* app/widgets/gimpbrushfactoryview.c
* app/widgets/gimpbufferview.c
* app/widgets/gimpcellrendererviewable.c
* app/widgets/gimpcellrendererviewable.h
* app/widgets/gimpcomponenteditor.c
* app/widgets/gimpcontainerbox.c
* app/widgets/gimpcontainercombobox.c
* app/widgets/gimpcontainereditor.c
* app/widgets/gimpcontainerentry.c
* app/widgets/gimpcontainergridview.c
* app/widgets/gimpcontainerpopup.c
* app/widgets/gimpcontainertreeview-dnd.c
* app/widgets/gimpcontainertreeview.c
* app/widgets/gimpcontainerview.c
* app/widgets/gimpdatafactoryview.c
* app/widgets/gimpitemtreeview.c
* app/widgets/gimplayertreeview.c
* app/widgets/gimpnavigationpreview.c
* app/widgets/gimppatternfactoryview.c
* app/widgets/gimppreviewrenderer-utils.c
* app/widgets/gimppreviewrendererbrush.c
* app/widgets/gimppreviewrendererbrush.h
* app/widgets/gimppreviewrendererdrawable.c
* app/widgets/gimppreviewrendererdrawable.h
* app/widgets/gimppreviewrenderergradient.c
* app/widgets/gimppreviewrenderergradient.h
* app/widgets/gimppreviewrendererimage.c
* app/widgets/gimppreviewrendererimage.h
* app/widgets/gimppreviewrendererimagefile.c
* app/widgets/gimppreviewrendererimagefile.h
* app/widgets/gimppreviewrendererlayer.c
* app/widgets/gimppreviewrenderervectors.c
* app/widgets/gimpselectioneditor.c
* app/widgets/gimptemplateview.c
* app/widgets/gimptooloptionseditor.c
* app/widgets/gimptoolview.c
* app/widgets/gimpview.c
* app/widgets/gimpview.h
* app/widgets/gimpviewablebutton.c
* app/widgets/widgets-enums.h
* app/widgets/widgets-types.h: Modified accordingly.
2004-08-25 22:31:44 +00:00
c04ddea85e app/actions/layers-actions.[ch] app/actions/layers-commands.[ch] added
2004-08-21  Sven Neumann  <sven@gimp.org>

	* app/actions/layers-actions.[ch]
	* app/actions/layers-commands.[ch]
	* app/widgets/gimplayertreeview.c: added actions to handle layer
	masks as suggested in bug #150446.

	* menus/layers-menu.xml: added menu entries for new actions,
	commented out raise/lower menu entries.
2004-08-20 22:32:14 +00:00
02d2b990f5 Redid the whole internal progress stuff: don't pass around
2004-08-10  Michael Natterer  <mitch@gimp.org>

	Redid the whole internal progress stuff: don't pass around
	progress_callback and progress_data; instead, provide a
	pointer to a GimpProgressInterface which can be implemented
	by a variety of backends.

	Addresses (but not yet fixes) bugs #6010, #97266 and #135185.

	* app/display/Makefile.am
	* app/display/gimpprogress.[ch]: removed the old progress hack.

	* app/core/Makefile.am
	* app/core/core-types.h
	* app/core/gimpprogress.[ch]: implement GimpProgressInterface.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpprogressdialog.[ch]: the standalone progress
	dialog as widget implementing GimpProgressInterface.

	* app/display/gimpdisplay.c
	* app/display/gimpstatusbar.[ch]
	* app/widgets/gimpfiledialog.[ch]
	* app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface
	implementation to these classes.

	* app/core/gimp-gui.[ch]
	* app/gui/gui-vtable.c: replaced the old progress vtable entries
	by two new to create and destroy a GimpProgressDialog in case
	no other progress is available.

	* app/pdb/procedural_db.[ch]
	* app/plug-in/plug-in-run.[ch]
	* tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and
	all plug-ins.

	* app/plug-in/plug-in.[ch]
	* app/plug-in/plug-ins.c
	* app/plug-in/plug-in-message.c
	* app/plug-in/plug-in-progress.c: handle the case there the
	plug-in was crated with a progress as well as the case where it
	wasn't.

	* app/app_procs.c
	* app/batch.c
	* app/xcf/xcf.c
	* app/file/file-open.[ch]
	* app/file/file-save.[ch]
	* app/widgets/gimphelp.c
	* app/widgets/gimpbrushselect.c
	* app/widgets/gimpfontselect.c
	* app/widgets/gimpgradientselect.c
	* app/widgets/gimppaletteselect.c
	* app/widgets/gimppatternselect.c: changed accordingly.

	* app/core/gimpimagefile.[ch]
	* app/display/gimpdisplayshell-dnd.c
	* app/gui/file-open-dialog.c
	* app/gui/file-open-location-dialog.c
	* app/gui/file-save-dialog.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file
	related functions. Embed the progress in the file dialog where
	possible.

	* app/core/gimpdrawable-blend.[ch]
	* app/core/gimpdrawable-transform.[ch]
	* app/core/gimpimage-convert.[ch]
	* app/core/gimpimage-flip.[ch]
	* app/core/gimpimage-resize.[ch]
	* app/core/gimpimage-rotate.[ch]
	* app/core/gimpimage-scale.[ch]
	* app/core/gimpitem-linked.[ch]
	* app/core/gimpitem.[ch]
	* app/core/gimpchannel.c
	* app/core/gimpdrawable.c
	* app/core/gimplayer.c
	* app/core/gimpselection.c
	* app/vectors/gimpvectors.c: replaced callback/data by GimpProgress.

	* app/tools/gimpblendtool.c
	* app/tools/gimptransformtool.c
	* app/gui/convert-dialog.c
	* app/actions/documents-commands.c
	* app/actions/file-commands.c
	* app/actions/image-commands.c
	* app/actions/layers-commands.c
	* app/actions/plug-in-commands.c
	* app/actions/vectors-commands.c
	* tools/pdbgen/pdb/convert.pdb
	* tools/pdbgen/pdb/edit.pdb
	* tools/pdbgen/pdb/image.pdb
	* tools/pdbgen/pdb/layer.pdb: changed callers accordingly.

	* app/pdb/*_cmds.c: regenerated.
2004-08-10 18:47:21 +00:00
0dabeab6cb #include "core/gimpimage-undo.h"
2004-08-04  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimplayertreeview.c: #include "core/gimpimage-undo.h"
2004-08-04 10:15:49 +00:00
b909c2b2ee new function which checks if undo compression is possible:
2004-08-03  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpimage-undo.[ch] (gimp_image_undo_can_compress):
	new function which checks if undo compression is possible:

	(1) is the image dirty? Fixes bug #148853.
	(2) is redo stack empty?
	(3) do both the passed undo object_type and undo_type
	    match the top undo item?

	Consistently name the GType and GimpUndoType passed to undo
	functions "object_type" and "undo_type" to avoid confusion.

	* app/actions/layers-commands.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimptexttool.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimplayertreeview.c: use the new utility function
	instead of checking the above conditions manually.
2004-08-03 14:09:49 +00:00
744bebc83c app/widgets/Makefile.am moved to libgimpwidgets.
2004-07-26  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/gimpcellrenderertoggle.[ch]: moved to libgimpwidgets.

	* app/widgets/gimpcomponenteditor.c
	* app/widgets/gimpcontainertreeview.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimptoolview.c
	* app/widgets/widgets-types.h

	* libgimpwidgets/Makefile.am
	* libgimpwidgets/gimpwidgets.def
	* libgimpwidgets/gimpwidgets.h
	* libgimpwidgets/gimpwidgetsmarshal.list
	* libgimpwidgets/gimpwidgetstypes.h
	* libgimpwidgets/gimpcellrenderertoggle.[ch]: custom toggle cell
	renderer moved here from app/widgets.

	* libgimpwidgets/gimpcellrenderercolor.[ch]: unified code with the
	new toggle cell renderer.
2004-07-26 21:09:16 +00:00
cc6aa18619 app/widgets/gimpdnd.[ch] app/widgets/gimpselectiondata.[ch] changed
2004-06-30  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpdnd.[ch]
	* app/widgets/gimpselectiondata.[ch]
	* app/widgets/gimpcontainertreeview.[ch]: changed "files" and "uris"
	to "uri_list" in all function names, parameters and typedefs.

	* app/widgets/gimpcontainertreeview-dnd.c
	* app/widgets/gimpdocumentview.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimptoolbox-dnd.c
	* app/display/gimpdisplayshell-dnd.[ch]
	* app/display/gimpdisplayshell.c: changed accordingly.
2004-06-30 14:47:23 +00:00
6a5e68c9e2 Allow all sorts of things to be dropped on or in between the items of a
2004-06-28  Michael Natterer  <mitch@gimp.org>

	Allow all sorts of things to be dropped on or in between the
	items of a GimpContainerTreeView:

	* app/widgets/gimpcontainertreeview.[ch]: added more parameters to
	GimpContainerTreeView::drop_possible() to specify where ecactly
	the drop should take place (between or into items) and to support
	dropping all sorts of things.

	Renamed ::drop() to ::drop_viewable() and added ::drop_color(),
	::drop_files() and ::drop_svg(), which cover all possible drop
	types.

	* app/widgets/gimpcontainertreeview-dnd.[ch]: changed accordingly.
	Dispatch all kinds of drops to the resp. virtual functions.

	* app/widgets/gimpitemtreeview.c: changed accordingly.

	* app/widgets/gimplayertreeview.c: allow to drop URIs, colors
	and patterns to the layers dialog. Fixes bugs #119506 and #139246.
2004-06-28 22:07:12 +00:00
63a4a72f79 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/gui/*.c:
	* app/widgets/*.c:
	* etc/templaterc: HIGify capitalization.  Should finish bug #123699
	except for everything I missed or got wrong.
2004-06-23 22:44:04 +00:00
62b59db976 app/display/gimpdisplayshell-scale.c app/gui/info-window.c
2004-06-02  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-scale.c
	* app/gui/info-window.c
	* app/gui/preferences-dialog.c
	* app/gui/resize-dialog.c
	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimplevelstool.c
	* app/tools/gimpthresholdtool.c
	* app/widgets/gimpdockable.c
	* app/widgets/gimpfiledialog.c
	* app/widgets/gimpgradienteditor.c
	* app/widgets/gimphistogrambox.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpstrokeeditor.c: tweaked some spacings for
	consistency and better HIG compliance.
2004-06-02 17:56:02 +00:00
2632cd8f64 app/actions/documents-actions.c app/actions/documents-commands.c
2004-05-12  Michael Natterer  <mitch@gimp.org>

	* app/actions/documents-actions.c
	* app/actions/documents-commands.c
	* app/actions/edit-actions.c
	* app/actions/edit-commands.[ch]
	* app/actions/layers-actions.c
	* app/actions/layers-commands.c
	* app/actions/select-actions.c
	* app/actions/select-commands.[ch]
	* app/actions/vectors-actions.c
	* app/actions/vectors-commands.[ch]: added tooltips for actions
	which are now used for dialog buttons, added callback
	implementations which formerly lived in various widgets, moved
	some actions around and did some general cleanups.

	* menus/image-menu.xml.in: s/edit-stroke/select-stroke/

	* menus/Makefile.am
	* menus/selection-editor-menu.xml: new popup menu.

	* app/menus/menus.c: register <SelectionEditor> and <UndoEditor>
	UI managers.

	* app/widgets/gimpeditor.[ch]: added construct properties
	"menu-factory", "menu-identifier", "ui-path" and "popup-data".
	Implement GObject::constructor() and create the UI manager
	if all needed properties were set. Enables creating action
	buttons at widget construction time because they need a
	UI manager.

	(gimp_editor_add_action_button): changed to take a va_list of
	"extended" actions which are invoked if the resp. button emits
	"extended_clicked". Store the actions and their modifier masks in
	a list attached to the button.

	* app/widgets/gimpcontainerview.c
	(gimp_container_view_item_selected): if the view has container
	*and* context, simply change the context and return.

	(gimp_container_view_context_changed): don't emit "select_item"
	manually but simply call gimp_container_view_select_item().

	(gimp_container_view_viewable_dropped): use
	gimp_container_view_item_selected() instead of changing the
	context directly.

	* app/widgets/gimpcontainereditor.c
	(gimp_container_editor_select_item): update the UI manager.

	* app/widgets/gimpdockable.c: don't try to fiddle with the
	dialog's menu if it doesn't have a ui_path (happens if the UI
	manager is just a collection of actions for the dialog buttons and
	has no menu registered).

	* app/widgets/gimpimageeditor.c: connect to the image's "flush"
	signal and update the UI manager in the callback.

	* app/widgets/gimpitemtreeview.c: use GimpEditor's construct
	properties to create the UI manager so GimpItemTreeView subclasses
	can have action buttons. Update the UI manager in
	gimp_item_tree_view_select_item().

	* app/widgets/gimpbufferview.c
	* app/widgets/gimpcolormapeditor.c
	* app/widgets/gimpcontainergridview.c
	* app/widgets/gimpdatafactoryview.c
	* app/widgets/gimpfontview.c
	* app/widgets/gimpimageview.c
	* app/widgets/gimptemplateview.c
	* app/widgets/gimptoolview.c: changed calls to
	gimp_editor_add_action_button() accordingly and removed some
	unneeded select_item() implementations.

	* app/widgets/gimpchanneltreeview.c
	* app/widgets/gimpvectorstreeview.[ch]
	* app/widgets/gimpdocumentview.[ch]
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpselectioneditor.[ch]
	* app/widgets/gimpundoeditor.[ch]: use action buttons and removed
	lots of callbacks which went to the resp. action callbacks.

	* app/widgets/widgets-types.h: removed some now unneeded function
	prototypes.

	* app/gui/dialogs-constructors.c: changed (simplified) many dialog
	constructors accordingly.
2004-05-12 18:36:33 +00:00
6750667d87 libgimpwidgets/gimpwidgets.c (gimp_scale_entry_new_internal) left-align
2004-05-12  Sven Neumann  <sven@gimp.org>

	* libgimpwidgets/gimpwidgets.c (gimp_scale_entry_new_internal)
	* app/widgets/gimpwidgets-utils.c (gimp_table_attach_stock):
	left-align the label.

	* app/actions/channels-commands.c
	* app/actions/layers-commands.c
	* app/actions/qmask-commands.c
	* app/actions/vectors-commands.c
	* app/display/gimpdisplayshell-scale.c
	* app/gui/brush-select.c
	* app/gui/file-new-dialog.c
	* app/gui/info-dialog.c
	* app/gui/info-window.c
	* app/gui/module-browser.c
	* app/gui/offset-dialog.c
	* app/gui/palette-import-dialog.c
	* app/gui/preferences-dialog.c
	* app/gui/resize-dialog.c
	* app/tools/gimpblendoptions.c
	* app/tools/gimpcroptool.c
	* app/tools/gimpmeasuretool.c
	* app/tools/gimppaintoptions-gui.c
	* app/tools/gimpscaletool.c
	* app/tools/gimpselectionoptions.c
	* app/tools/gimpsheartool.c
	* app/tools/gimptextoptions.c
	* app/widgets/gimpcolormapeditor.c
	* app/widgets/gimpgrideditor.c
	* app/widgets/gimphistogrameditor.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpstrokeeditor.c
	* app/widgets/gimpwidgets-utils.c: left-align labels as suggested
	by the HIG.
2004-05-12 11:37:21 +00:00
181a581f6e app/widgets/gimpchanneltreeview.c app/widgets/gimpcontainerbox.[ch]
2004-05-11  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpchanneltreeview.c
	* app/widgets/gimpcontainerbox.[ch]
	* app/widgets/gimpcontainereditor.c
	* app/widgets/gimpcontainergridview.[ch]
	* app/widgets/gimpcontainerpopup.c
	* app/widgets/gimpcontainertreeview.[ch]
	* app/widgets/gimpdatafactoryview.c
	* app/widgets/gimpdocumentview.c
	* app/widgets/gimpfontview.c
	* app/widgets/gimpimageview.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimppatternfactoryview.c
	* app/widgets/gimptemplateview.c
	* app/widgets/gimpvectorstreeview.c: code review / cleanup.
2004-05-11 10:01:25 +00:00
930b621b8c app/widgets/widgets-types.h made GimpContainerView an interface. Added
2004-05-11  Michael Natterer  <mitch@gimp.org>

	* app/widgets/widgets-types.h
	* app/widgets/gimpcontainerview.[ch]: made GimpContainerView an
	interface. Added accessors for all members in the private struct
	and made it really private.

	* app/widgets/gimpcontainerbox.[ch]: derive it from GimpEditor and
	implement GimpContainerViewInterface and its properties.

	* app/widgets/gimpchanneltreeview.c
	* app/widgets/gimpcontainergridview.c
	* app/widgets/gimpcontainertreeview.c
	* app/widgets/gimpcontainertreeview-dnd.c
	* app/widgets/gimpdrawabletreeview.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpvectorstreeview.c: implement
	GimpContainerViewInterface and use the new accessor functions.

	* app/widgets/gimpcontainerpopup.c
	* app/widgets/gimpdocumentview.c: changed accordingly.

	* app/widgets/gimptemplateview.c
	* app/widgets/gimpcontainereditor.c
	* app/widgets/gimpundoeditor.c
	* app/actions/palettes-commands.c: #include "gimpcontainerview.h"
2004-05-10 23:22:39 +00:00
3adc0816e6 More GimpContainerView chopping:
2004-05-10  Michael Natterer  <mitch@gimp.org>

	More GimpContainerView chopping:

	* app/widgets/gimpcontainerview.[ch]: added
	GimpContainerViewPrivate struct (which is currently puclic :-) and
	removed all members from the GimpContainerView struct. Added
	accessors for "context", "container" and "preview_size /
	preview_border_width". Added macro to get the private struct
	(*not* via G_TYPE_INSTANCE_GET_PRIVATE because that's unavailable
	for interfaces).

	* app/widgets/gimpbrushfactoryview.c
	* app/widgets/gimpbufferview.c
	* app/widgets/gimpchanneltreeview.c
	* app/widgets/gimpcontainerbox.c
	* app/widgets/gimpcontainereditor.c
	* app/widgets/gimpcontainergridview.c
	* app/widgets/gimpcontainerpopup.c
	* app/widgets/gimpcontainertreeview-dnd.c
	* app/widgets/gimpcontainertreeview.c
	* app/widgets/gimpdatafactoryview.c
	* app/widgets/gimpdocumentview.c
	* app/widgets/gimpfontview.c
	* app/widgets/gimpimageview.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpsessioninfo.c
	* app/widgets/gimptemplateview.c
	* app/widgets/gimptoolview.c
	* app/actions/brushes-actions.c
	* app/actions/buffers-actions.c
	* app/actions/dockable-actions.c
	* app/actions/dockable-commands.c
	* app/actions/documents-actions.c
	* app/actions/fonts-actions.c
	* app/actions/gradients-actions.c
	* app/actions/gradients-commands.c
	* app/actions/images-actions.c
	* app/actions/palettes-actions.c
	* app/actions/palettes-commands.c
	* app/actions/patterns-actions.c
	* app/actions/templates-actions.c
	* app/actions/tools-actions.c
	* app/actions/tools-commands.c: changed accordingly.
2004-05-10 17:16:50 +00:00
5e3b9ec330 added new function gimp_paint_mode_menu_set_history().
2004-04-20  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpwidgets-constructors.[ch]: added new function
	gimp_paint_mode_menu_set_history().

	* app/gui/brush-select.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimppropwidgets.c: use the new function instead of
	the deprecated gimp_int_option_menu API.
2004-04-20 13:10:50 +00:00
5e47b5a0ed Make it possible to refresh the preview of an undo step.
2004-03-20  Simon Budig  <simon@gimp.org>

	* app/core/gimpundo.[ch]: Make it possible to refresh the preview
	of an undo step.

	* app/tools/gimpeditselectiontool.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimplayertreeview.c: refresh the preview when
	compressing undos. This ensures that the last preview in the undo
	history always reflects the current state of the image.
2004-03-19 23:42:42 +00:00
23711e13d3 app/gui/channels-commands.c app/gui/layers-commands.c Make sure that
2004-03-17  Simon Budig  <simon@gimp.org>

	* app/gui/channels-commands.c
	* app/gui/layers-commands.c
	* app/gui/vectors-commands.c: Make sure that non-dialog creation
	of layer/channels/vectors properly updates the image. Also
	clear the new channel unconditionally.

	Change the name of the newly created item to not include the "Copy".
	It isn't a copy.

	* app/widgets/gimpitemtreeview.c: Don't try to assemble translated
	strings.

	* app/widgets/gimpchanneltreeview.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpvectorstreeview.c: properly overwrite the
	tooltip for the "New" button.

	Sorry, some real string changes ahere, but they were necessary.
2004-03-17 16:12:21 +00:00
4aef30a5aa app/widgets/gimplayertreeview.c app/widgets/gimpvectorstreeview.c remove
2004-03-17  Simon Budig  <simon@gimp.org>

	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpvectorstreeview.c
	* app/widgets/gimpdatafactoryview.c: remove basically useless
	edit buttons in the layers, vectors and patterns dialog.

	* app/widgets/gimpitemtreeview.c: Make Shift-Click on the "New"
	button create a new item using defaults.
2004-03-16 23:45:48 +00:00
b3cc15783b app/widgets/widgets-enums.h New function
2004-03-13  Simon Budig  <simon@gimp.org>

	* app/widgets/widgets-enums.h
	* app/widgets/gimppreviewrenderer.[ch]: New function
	gimp_preview_renderer_set_border_type that takes an enum instead
	of an color to set the color of the border.

	* app/widgets/gimpcellrendererviewable.c: check for the
	current border_type and change it to black when it is white and
	the cell is unselected. This should be solved in a better way
	later.

	Fixes bug #135023.

	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpcontainergridview.c: changed to use the new
	function.
2004-03-13 16:54:35 +00:00
dade4a8430 app/tools/gimpeditselectiontool.c compress undo steps only if the redo
2004-03-02  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpeditselectiontool.c
	* app/widgets/gimplayertreeview.c: compress undo steps only
	if the redo stack is empty.
2004-03-02 14:33:31 +00:00
95ae8410d7 compress successive layer mode undos just as we compress opacity undos.
2003-11-19  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimplayertreeview.c
	(gimp_layer_tree_view_paint_mode_menu_callback): compress
	successive layer mode undos just as we compress opacity undos.
2003-11-19 17:03:20 +00:00