Commit Graph

176 Commits

Author SHA1 Message Date
ecb2c46dc8 app/actions/layers-commands.c app/core/gimpchannel-combine.c
2007-12-23  Michael Natterer  <mitch@gimp.org>

	* app/actions/layers-commands.c
	* app/core/gimpchannel-combine.c
	* app/core/gimpchannel-select.c
	* app/core/gimpchannel.c
	* app/core/gimpdrawable-convert.c
	* app/core/gimpdrawable.c
	* app/core/gimpdrawablemodundo.c
	* app/core/gimpfloatingselundo.c
	* app/core/gimpimage-convert.c
	* app/core/gimpimage-merge.c
	* app/core/gimpimage-resize.c
	* app/core/gimpimage.c
	* app/core/gimpitem-preview.c
	* app/core/gimpitem.c
	* app/core/gimplayer-floating-sel.c
	* app/core/gimplayer.c
	* app/core/gimplayermask.c
	* app/core/gimplayerundo.c
	* app/core/gimpmaskundo.c
	* app/core/gimppalette-import.c
	* app/core/gimpprojection-construct.c
	* app/core/gimpselection.c
	* app/dialogs/offset-dialog.c
	* app/text/gimptextlayer-xcf.c
	* app/text/gimptextlayer.c
	* app/vectors/gimpvectors-compat.c
	* app/vectors/gimpvectors.c
	* app/vectors/gimpvectorsmodundo.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpviewrendererdrawable.c
	* app/widgets/gimpviewrenderervectors.c: use accessors for item,
	layer, channel and mask attributes.


svn path=/trunk/; revision=24429
2007-12-23 16:58:41 +00:00
734e02f121 app/widgets/Makefile.am new files holding Cairo utility functions.
2007-11-02  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/gimpcairo-utils.[ch]: new files holding Cairo
	utility functions.

	* app/widgets/gimpviewrenderer.[ch]: ported partly to Cairo 
drawing.

	* app/widgets/gimpcomponenteditor.c
	* app/widgets/gimpcontainercombobox.c
	* app/widgets/gimpcontainertreeview.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpview.c: removed calls to
	gimp_view_renderer_unrealize() which are not needed anymore
	because we don't allocate a GC in the renderer any longer.

	* app/widgets/gimpcellrendererdashes.c: removed a redundant 
cast.


svn path=/trunk/; revision=24039
2007-11-01 23:37:00 +00:00
9b369d8f6b documentation.
2007-05-21  Sven Neumann  <sven@gimp.org>

	* app/core/gimp.c (gimp_message): documentation.

	* app/actions/documents-commands.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimptoolbox-dnd.c: pass parent widgets to gimp_message().

svn path=/trunk/; revision=22552
2007-05-21 16:32:52 +00:00
59269cf704 don't do stuff on NULL mask view renderers. Fixes bug #389307.
2006-12-25  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimplayertreeview.c
	(gimp_layer_tree_view_set_context): don't do stuff on NULL mask
	view renderers. Fixes bug #389307.
2006-12-25 14:51:53 +00:00
41237259c9 In all files, changed the standard copyright notice to say "GIMP - The GNU
2006-12-09  Sven Neumann  <sven@gimp.org>

        * In all files, changed the standard copyright notice to say
        "GIMP - The GNU Image Manipulation Program".
2006-12-09 21:33:38 +00:00
e896521924 added gimp_image_add_layers() which takes a list of layers and vierport
2006-11-03  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpimage.[ch]: added gimp_image_add_layers() which
	takes a list of layers and vierport coordinates to center the
	layers in.

	* app/dialogs/file-open-dialog.c
	* app/display/gimpdisplayshell-dnd.c
	* app/widgets/gimplayertreeview.c: use it instead of having the
	same code three times.
2006-11-03 19:59:30 +00:00
725a4e414f added value GIMP_UNDO_GROUP_LAYER_ADD.
2006-11-03  Michael Natterer  <mitch@gimp.org>

	* app/core/core-enums.[ch] (enum GimpUndoType): added value
	GIMP_UNDO_GROUP_LAYER_ADD.

	* app/file/file-open.[ch]: changed file_open_layer() to
	file_open_layers(), added parameter "gboolean merge_visible",
	return a GList of layers.

	* app/dialogs/file-open-dialog.c
	* app/display/gimpdisplayshell-dnd.c
	* app/widgets/gimplayertreeview.c: pass merge_visible = FALSE and
	add all returned layers to the image. Fixes bug #358082.
	(contains lots of duplicated code, will factor that out later).

	* tools/pdbgen/pdb/fileops.pdb (load_layer): pass merge_visible = TRUE
	(load_layers): new wrapper which returns all the image's layers.

	* app/pdb/fileops_cmds.c
	* app/pdb/internal_procs.c
	* libgimp/gimpfileops_pdb.[ch]: regenerated.

	* libgimp/gimp.def: changed accordingly.
2006-11-03 17:12:27 +00:00
e634d4d718 Added "Edit -> Fade" which allows to modify the paint mode and opacity of
2006-10-21  Michael Natterer  <mitch@gimp.org>

	Added "Edit -> Fade" which allows to modify the paint mode and
	opacity of the last drawable operation (fill, plugins etc.).
	Started from a patch by Bill Skaggs. Fixes bug #170707.

	* app/base/base-enums.[ch] (enum GimpLayerModeEffects): register
	the values REPLACE_MODE, ERASE_MODE and ANTI_ERASE_MODE with
	the type system.

	* app/widgets/gimppropwidgets.[ch]
	* app/widgets/gimpwidgets-constructors.[ch]: added "gboolean
	with_replace_modes" to the paint mode menu constructors.

	* app/tools/gimppaintoptions-gui.c
	* app/widgets/gimpbrushselect.c
	* app/widgets/gimplayertreeview.c: pass with_replace_modes = FALSE.

	* app/core/gimpdrawableundo.[ch]: added members which keep tiles,
	paint mode and opacity of the pasted pixels.

	* app/core/gimpimage-undo.[ch] (gimp_image_undo_get_fadeable):
	returns a GimpUndo suitable for a fade operation, or NULL.

	* app/core/gimp-edit.[ch] (gimp_edit_fade): implements the actual
	fade by undoing the last operation and then re-applying the pixels
	with different paint mode and opacity.

	* app/core/gimpdrawable-combine.c: store the pasted pixels in
	the GimpDrawableUndo.

	* app/actions/edit-actions.c
	* app/actions/edit-commands.[ch]: action and callback for fade.

	* app/dialogs/Makefile.am
	* app/dialogs/fade-dialog.[ch]: the fade dialog.

	* app/widgets/gimphelp-ids.h: the fade help ID.

	* menus/image-menu.xml.in: added a menu entry in "Edit".
2006-10-21 18:46:49 +00:00
ee8039a062 #include "core/gimp.h" for gimp_message().
2006-10-16  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimplayertreeview.c: #include "core/gimp.h" for
	gimp_message().
2006-10-16 13:46:28 +00:00
1ed8dd4f53 app/actions/data-commands.c app/actions/documents-commands.c
2006-10-09  Michael Natterer  <mitch@gimp.org>

	* app/actions/data-commands.c
	* app/actions/documents-commands.c
	* app/actions/drawable-commands.c
	* app/actions/gradients-commands.c
	* app/actions/image-commands.c
	* app/actions/layers-commands.c
	* app/actions/palettes-commands.c
	* app/actions/select-commands.c
	* app/actions/vectors-commands.c
	* app/core/gimp-contexts.c
	* app/core/gimp-documents.c
	* app/core/gimp-edit.c
	* app/core/gimp-modules.c
	* app/core/gimp-parasites.c
	* app/core/gimp-templates.c
	* app/core/gimp-units.c
	* app/core/gimpchannel.c
	* app/core/gimpdatafactory.[ch]
	* app/core/gimpdrawable-bucket-fill.c
	* app/core/gimpimage-merge.c
	* app/core/gimpimagefile.c
	* app/core/gimplayer-floating-sel.c
	* app/core/gimppdbprogress.c
	* app/core/gimpselection.c
	* app/dialogs/palette-import-dialog.c
	* app/display/gimpdisplayshell-dnd.c
	* app/gui/session.c
	* app/gui/themes.c
	* app/pdb/gimpprocedure.c
	* app/plug-in/gimpplugin-message.c
	* app/plug-in/gimpplugin.c
	* app/plug-in/gimppluginmanager-file.c
	* app/plug-in/gimppluginmanager.c
	* app/text/gimptextlayer-xcf.c
	* app/text/gimptextlayer.c
	* app/widgets/gimpcontrollers.c
	* app/widgets/gimpdataeditor.c
	* app/widgets/gimpdevices.c
	* app/widgets/gimpdnd-xds.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimptoolbox-dnd.c
	* app/widgets/gimptoolbox.c
	* app/widgets/gimpuimanager.c
	* app/widgets/gimpvectorstreeview.c
	* tools/pdbgen/pdb/brush.pdb
	* tools/pdbgen/pdb/gradient.pdb
	* tools/pdbgen/pdb/palette.pdb: convert lots of g_message() to
	gimp_message(). Make sure we never pass unknown strings (like
	error->message) to printf-like functions directly; run them
	thorugh "%s" instead. Don't translate some messages which should
	never happen.

	* app/pdb/brush_cmds.c
	* app/pdb/gradient_cmds.c
	* app/pdb/palette_cmds.c: regenerated.
2006-10-09 18:49:15 +00:00
875342af5d support setting a context even if the viewed container's children_type is
2006-08-31  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainerview.c
	(gimp_container_view_real_set_container)
	(gimp_container_view_real_set_context)
	(gimp_container_view_item_selected)
	(gimp_container_view_thaw): support setting a context even if
	the viewed container's children_type is *not* a property of
	GimpContext. This removes a major restriction of container
	views and allows to get rid of some hacks:

	* app/widgets/gimpitemtreeview.[ch]: removed GimpContext member
	and implement GimpContainerView::set_context() instead of
	GimpDocked::set_context().

	* app/widgets/gimpchanneltreeview.c
	* app/widgets/gimpcontainergridview.c
	* app/widgets/gimpcontainertreeview.c
	* app/widgets/gimpdrawabletreeview.c
	* app/widgets/gimplayertreeview.c: use GimpContainerView's context
	instead of GimpItemTreeView's and implement GimpContainerView's
	set_context() instead of GimpDocked's.

	* app/actions/actions.c (action_data_get_gimp)
	(action_data_get_context): don't special-case GimpItemTreeView any
	more, it's just like a normal GimpContainerView now.

	* app/widgets/gimpcontrollerlist.c
	(gimp_controller_list_constructor): set a context on the
	GimpContainerView so its renderers have a context to use.
2006-08-31 21:40:16 +00:00
b53aa45a76 Changed GimpViewable preview rendering to have a context to get
2006-08-29  Michael Natterer  <mitch@gimp.org>

	Changed GimpViewable preview rendering to have a context to get
	FG/BG/whatever from. Use the context to enable dynamic FG/BG
	colors in gradients. Fixes bug #127676 and bug #352214. Addresses
	bug #128367 (doesn't fix it because there's no loading/saving and
	no GUI yet).

	* app/core/core-enums.[ch]: added enum GimpGradientColor to enable
	specifying gradient colors in terms of foreground and background.

	* app/core/gimpgradient.[ch]: added color_type members to the
	GimpGradientSegment struct and honor them in
	gimp_gradient_get_color_at(). Added GimpContext parameters to all
	functions which finally call get_color_at().

	* app/core/gimp-gradients.c: use the new method to implement the
	builtin gradients.

	* app/core/gimpviewable.[ch]: added GimpContext parameters to all
	get_preview() and get_pixbuf() functions.

	* app/core/gimpbrush.c
	* app/core/gimpbuffer.c
	* app/core/gimpdrawable-preview.[ch]
	* app/core/gimpgradient.c
	* app/core/gimpimage-preview.[ch]
	* app/core/gimpimagefile.c
	* app/core/gimppalette.c
	* app/core/gimppattern.c
	* app/core/gimpundo.[ch]
	* app/text/gimpfont.c
	* app/vectors/gimpvectors-preview.[ch]: changed ::get_preview()
	and ::get_pixbuf() implementations accordingly.

	* app/core/gimpdrawable-blend.c
	* app/core/gimppalette-import.[ch]
	* app/dialogs/dialogs-constructors.c
	* app/dialogs/palette-import-dialog.c
	* app/dialogs/resize-dialog.c
	* app/display/gimpdisplayshell-layer-select.c
	* app/display/gimpdisplayshell.c
	* app/display/gimpnavigationeditor.c
	* app/paint/gimppaintoptions.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimptexttool.c
	* app/actions/gradient-editor-commands.c
	* app/widgets/gimpaction.c
	* app/widgets/gimpbrusheditor.[ch]
	* app/widgets/gimpbufferview.c
	* app/widgets/gimpcellrendererviewable.c
	* app/widgets/gimpchanneltreeview.c
	* app/widgets/gimpclipboard.c
	* app/widgets/gimpcoloreditor.c
	* app/widgets/gimpcomponenteditor.c
	* app/widgets/gimpcontainerbox.c
	* app/widgets/gimpcontainercombobox.c
	* app/widgets/gimpcontainereditor.c
	* app/widgets/gimpcontainerentry.c
	* app/widgets/gimpcontainergridview.c
	* app/widgets/gimpcontainertreeview.[ch]
	* app/widgets/gimpdataeditor.[ch]
	* app/widgets/gimpdevicestatus.c
	* app/widgets/gimpdnd.[ch]
	* app/widgets/gimpdrawabletreeview.c
	* app/widgets/gimpfiledialog.c
	* app/widgets/gimpgradienteditor.[ch]
	* app/widgets/gimpgradientselect.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimppaletteeditor.[ch]
	* app/widgets/gimppropwidgets.[ch]
	* app/widgets/gimpselectioneditor.c
	* app/widgets/gimpthumbbox.[ch]
	* app/widgets/gimptoolbox-image-area.c
	* app/widgets/gimptoolbox-indicator-area.c
	* app/widgets/gimptooloptionseditor.c
	* app/widgets/gimpundoeditor.c
	* app/widgets/gimpvectorstreeview.c
	* app/widgets/gimpview-popup.[ch]
	* app/widgets/gimpview.[ch]
	* app/widgets/gimpviewablebutton.c
	* app/widgets/gimpviewabledialog.c
	* app/widgets/gimpviewrenderer.[ch]
	* app/widgets/gimpviewrenderer-frame.c
	* app/widgets/gimpviewrendererbrush.c
	* app/widgets/gimpviewrendererbuffer.c
	* app/widgets/gimpviewrendererdrawable.c
	* app/widgets/gimpviewrenderergradient.c
	* app/widgets/gimpviewrendererimage.c
	* tools/pdbgen/pdb/drawable.pdb
	* tools/pdbgen/pdb/gradient.pdb
	* tools/pdbgen/pdb/gradients.pdb
	* tools/pdbgen/pdb/image.pdb: added tons of GimpContext members
	and parameters, implement GimpDocked::set_context() in many
	widgets. Pass these locally remembered contexts to GimpViewable
	functions. Did some minor cleanups on the way. There are still
	some minor FIXMEs around where the code uses a NULL context (which
	is allowed by the APIs)

	* app/pdb/drawable_cmds.c
	* app/pdb/gradient_cmds.c
	* app/pdb/gradients_cmds.c
	* app/pdb/image_cmds.c: regenerated.
2006-08-29 21:44:51 +00:00
c2fb42003a introduced a simple message dialog to use when there's no progress but a
2006-08-11  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpwidgets-utils.[ch]: introduced a simple message
	dialog to use when there's no progress but a parent widget.

	* app/dialogs/convert-dialog.c
	* app/dialogs/palette-import-dialog.c
	* app/dialogs/preferences-dialog.c
	* app/dialogs/stroke-dialog.c
	* app/tools/gimpimagemaptool.c
	* app/widgets/gimpactionview.c
	* app/widgets/gimpcontrollerlist.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimppdbdialog.c
	* app/widgets/gimpvectorstreeview.c: use the new utility function
	instead of g_message().
2006-08-11 12:56:26 +00:00
6ebcf700d1 removed erroneous semicolon after G_DEFINE_TYPE macros.
2006-05-15  Sven Neumann  <sven@gimp.org>

	* app/*/*.c:
	* lib*/*.c: removed erroneous semicolon after G_DEFINE_TYPE macros.
2006-05-15 09:46:31 +00:00
5fc9bd4096 app/actions/tool-options-commands.c app/core/gimp.c
2006-04-07  Sven Neumann  <sven@gimp.org>

	* app/actions/tool-options-commands.c
	* app/core/gimp.c
	* app/core/gimpbrushpipe.c
	* app/core/gimpbuffer.c
	* app/core/gimpcontext.c
	* app/core/gimpdatafactory.c
	* app/core/gimpgradient-load.c
	* app/core/gimpimage-merge.c
	* app/core/gimpimage-undo-push.c
	* app/core/gimpitem.c
	* app/core/gimplayer.c
	* app/core/gimplayermask.c
	* app/core/gimplist.c
	* app/core/gimppalette.c
	* app/dialogs/template-options-dialog.c
	* app/display/gimpdisplayshell-dnd.c
	* app/file/file-open.c
	* app/paint/gimp-paint.c
	* app/widgets/gimpdataeditor.c
	* app/widgets/gimpdatafactoryview.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimptemplateview.c
	* app/widgets/gimptoolbox-dnd.c: use gimp_object_set_static_name()
	and gimp_object_take_name() where appropriate.
2006-04-07 10:51:22 +00:00
905fdfcbed did a global gimage -> image substitution.
2006-03-28  Sven Neumann  <sven@gimp.org>

	* app/*: did a global gimage -> image substitution.
2006-03-28 17:08:36 +00:00
017278c111 app/dialogs/file-open-dialog.c app/display/gimpdisplayshell-dnd.c
2006-03-03  Sven Neumann  <sven@gimp.org>

	* tools/pdbgen/pdb/fileops.pdb:
	* app/dialogs/file-open-dialog.c
	* app/display/gimpdisplayshell-dnd.c
	* app/file/file-open.[ch]
	* app/widgets/gimplayertreeview.c: pass the selected load procedure
	to file_open_layer() or NULL if none is selected. Fixes bug #333207.

	* app/pdb/fileops_cmds.c: regenerated.
2006-03-03 19:51:20 +00:00
5236dc6f13 app/actions/dockable-actions.c app/actions/dockable-commands.[ch]
2006-01-17  Michael Natterer  <mitch@gimp.org>

	* app/actions/dockable-actions.c
	* app/actions/dockable-commands.[ch]
	* app/dialogs/dialogs-constructors.[ch]
	* app/dialogs/dialogs.c
	* app/display/gimpdisplayshell-layer-select.c
	* app/widgets/gimpbrusheditor.[ch]
	* app/widgets/gimpbrushfactoryview.h
	* app/widgets/gimpbufferview.[ch]
	* app/widgets/gimpchanneltreeview.c
	* app/widgets/gimpcomponenteditor.[ch]
	* app/widgets/gimpcontainerbox.c
	* app/widgets/gimpcontainercombobox.[ch]
	* app/widgets/gimpcontainereditor.[ch]
	* app/widgets/gimpcontainerentry.[ch]
	* app/widgets/gimpcontainergridview.[ch]
	* app/widgets/gimpcontainerpopup.[ch]
	* app/widgets/gimpcontainertreeview.[ch]
	* app/widgets/gimpcontainerview.[ch]
	* app/widgets/gimpdatafactoryview.[ch]
	* app/widgets/gimpdevicestatus.c
	* app/widgets/gimpdialogfactory.[ch]
	* app/widgets/gimpdocumentview.[ch]
	* app/widgets/gimpfontview.[ch]
	* app/widgets/gimpgradienteditor.[ch]
	* app/widgets/gimpimageview.[ch]
	* app/widgets/gimpitemtreeview.[ch]
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpmenudock.c
	* app/widgets/gimppatternfactoryview.[ch]
	* app/widgets/gimppropwidgets.[ch]
	* app/widgets/gimpselectioneditor.[ch]
	* app/widgets/gimpsessioninfo.[ch]
	* app/widgets/gimptemplateview.[ch]
	* app/widgets/gimptooloptionseditor.c
	* app/widgets/gimptoolview.[ch]
	* app/widgets/gimpundoeditor.[ch]
	* app/widgets/gimpviewablebox.c
	* app/widgets/gimpviewablebutton.[ch]
	* app/widgets/gimpviewabledialog.[ch]
	* app/widgets/gimpviewrenderer.c: change the word "preview" to
	"view" whereever we talk about GimpView or GimpViewRenderer
	objects or their sizes. Ther were renamed from "Preview" a long
	time ago and we had a preview/view naming mess ever since.
2006-01-17 10:08:50 +00:00
61df53ec54 port to G_DEFINE_TYPE() and friends. Some related cleanup.
2005-12-19  Michael Natterer  <mitch@gimp.org>

	* app/widgets/*.c: port to G_DEFINE_TYPE() and friends. Some
	related cleanup.
2005-12-19 22:37:49 +00:00
6912227651 added run-mode parameter to file_open_layer().
2005-10-17  Sven Neumann  <sven@gimp.org>

	* app/file/file-open.[ch]: added run-mode parameter to
	file_open_layer().

	* app/dialogs/file-open-dialog.c
	* app/display/gimpdisplayshell-dnd.c
	* app/widgets/gimplayertreeview.c: pass GIMP_RUN_INTERACTIVE to
	file_open_layer().

	* tools/pdbgen/pdb/fileops.pdb: export file_open_layer() to the PDB
	as file-load-layer.

	* app/pdb/fileops_cmds.c
	* app/pdb/internal_procs.c
	* libgimp/gimpfileops_pdb.[ch]: regenerated.

	* libgimp/gimp.def: updated.
2005-10-17 15:15:20 +00:00
ee64ca3c90 introduced variants of file_utils_uri_to_utf8_filename() and
2005-10-02  Sven Neumann  <sven@gimp.org>

	* app/file/file-utils.[ch]: introduced variants of
	file_utils_uri_to_utf8_filename() and
	file_utils_uri_to_utf8_basename() that use g_filename_display_name()
	and g_filename_display_basename().

	* app/actions/data-commands.c
	* app/actions/documents-commands.c
	* app/actions/file-actions.c
	* app/actions/file-commands.c
	* app/core/gimpimage.c
	* app/core/gimpimagefile.c
	* app/dialogs/file-open-dialog.c
	* app/dialogs/file-open-location-dialog.c
	* app/dialogs/file-save-dialog.c
	* app/dialogs/palette-import-dialog.c
	* app/display/gimpdisplayshell-close.c
	* app/display/gimpdisplayshell-dnd.c
	* app/display/gimpdisplayshell-title.c
	* app/file/file-open.c
	* app/widgets/gimpdnd-xds.c
	* app/widgets/gimpfiledialog.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpthumbbox.c
	* app/widgets/gimptoolbox-dnd.c
	* app/widgets/gimptoolbox.c
	* app/widgets/gimpviewabledialog.c: use the new functions.

	* plug-ins/help/domain.c: use g_filename_display_name().
2005-10-01 22:43:22 +00:00
805602b657 if the floating selection has no alpha, manually create BoundSegs of its
2005-09-08  Michael Natterer  <mitch@gimp.org>

	* app/core/gimplayer-floating-sel.c (floating_sel_boundary): if
	the floating selection has no alpha, manually create BoundSegs of
	its outline instead of calling boundary_find() (which creates a
	boundary of the last channel). Fixes bug #145373.

	* app/widgets/gimplayertreeview.c
	(gimp_layer_tree_view_floating_selection_changed): update all
	layer names' text attributes, not only for layers with alpha.
	Fixes layer name display when making a new layer out of a floating
	selection without alpha.
2005-09-08 19:38:58 +00:00
32d875d070 app/dialogs/module-dialog.c app/dialogs/palette-import-dialog.c
2005-08-03  Michael Natterer  <mitch@gimp.org>

	* app/dialogs/module-dialog.c
	* app/dialogs/palette-import-dialog.c
	* app/gui/gui.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimpimagemaptool.c
	* app/tools/gimplevelstool.c
	* app/tools/gimpvectortool.c
	* app/widgets/gimpaction.c
	* app/widgets/gimpcoloreditor.c
	* app/widgets/gimpcontainerbox.c
	* app/widgets/gimpcontainertreeview.c
	* app/widgets/gimpcursorview.c
	* app/widgets/gimpdnd.c
	* app/widgets/gimpdock.c
	* app/widgets/gimpdockbook.c
	* app/widgets/gimpdrawabletreeview.c
	* app/widgets/gimpeditor.c
	* app/widgets/gimpenumaction.c
	* app/widgets/gimperrordialog.c
	* app/widgets/gimpfileprocview.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpmenudock.c
	* app/widgets/gimpmessagebox.c
	* app/widgets/gimpmessagedialog.c
	* app/widgets/gimppluginaction.c
	* app/widgets/gimpprogressdialog.c
	* app/widgets/gimpsamplepointeditor.c
	* app/widgets/gimpstringaction.c
	* app/widgets/gimptemplateeditor.c
	* app/widgets/gimptoolbox-image-area.c
	* app/widgets/gimptoolbox.c: use canonical names for signals and
	properties.
2005-08-03 09:34:55 +00:00
e1be822e3d moved the lock alpha toggle to a separate "Lock:" line.
2005-07-10  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimplayertreeview.c (gimp_layer_tree_view_init):
	moved the lock alpha toggle to a separate "Lock:" line.
2005-07-10 21:24:21 +00:00
20b4769cf5 app/actions/layers-actions.c app/actions/layers-commands.[ch]
2005-07-10  Michael Natterer  <mitch@gimp.org>

	* app/actions/layers-actions.c
	* app/actions/layers-commands.[ch]
	* app/core/core-enums.[ch]
	* app/core/gimpimage-undo-push.[ch]
	* app/core/gimplayer-floating-sel.c
	* app/core/gimplayer.[ch]
	* app/text/gimptextlayer-xcf.c
	* app/widgets/gimphelp-ids.h
	* app/widgets/gimplayertreeview.[ch]
	* app/xcf/xcf-load.c
	* app/xcf/xcf-private.h
	* app/xcf/xcf-save.c
	* tools/pdbgen/pdb/layer.pdb
	* menus/image-menu.xml.in
	* libgimp/gimp.def: did a global s/preserve_trans/lock_alpha/ in
	preparation for more layer locking flags.

	* app/pdb/procedural_db.c
	* libgimp/gimplayer.[ch]: added compat stuff for preserve_trans.

	* app/pdb/layer_cmds.c
	* libgimp/gimplayer_pdb.[ch]: regenerated.

	* plug-ins/common/colortoalpha.c
	* plug-ins/common/iwarp.c
	* plug-ins/common/psd.c
	* plug-ins/common/psd_save.c
	* plug-ins/common/psp.c
	* plug-ins/common/rotate.c
	* plug-ins/common/threshold_alpha.c
	* plug-ins/common/vpropagate.c
	* plug-ins/script-fu/scripts/3d-outline.scm
	* plug-ins/script-fu/scripts/alien-glow-bar.scm
	* plug-ins/script-fu/scripts/alien-glow-bullet.scm
	* plug-ins/script-fu/scripts/alien-glow-logo.scm
	* plug-ins/script-fu/scripts/basic1-logo.scm
	* plug-ins/script-fu/scripts/basic2-logo.scm
	* plug-ins/script-fu/scripts/beveled-pattern-button.scm
	* plug-ins/script-fu/scripts/blend-anim.scm
	* plug-ins/script-fu/scripts/blended-logo.scm
	* plug-ins/script-fu/scripts/bovinated-logo.scm
	* plug-ins/script-fu/scripts/burn-in-anim.scm
	* plug-ins/script-fu/scripts/carved-logo.scm
	* plug-ins/script-fu/scripts/chalk.scm
	* plug-ins/script-fu/scripts/chip-away.scm
	* plug-ins/script-fu/scripts/comic-logo.scm
	* plug-ins/script-fu/scripts/coolmetal-logo.scm
	* plug-ins/script-fu/scripts/crystal-logo.scm
	* plug-ins/script-fu/scripts/drop-shadow.scm
	* plug-ins/script-fu/scripts/gimp-headers.scm
	* plug-ins/script-fu/scripts/gimp-labels.scm
	* plug-ins/script-fu/scripts/glowing-logo.scm
	* plug-ins/script-fu/scripts/gradient-bevel-logo.scm
	* plug-ins/script-fu/scripts/image-structure.scm
	* plug-ins/script-fu/scripts/neon-logo.scm
	* plug-ins/script-fu/scripts/perspective-shadow.scm
	* plug-ins/script-fu/scripts/starburst-logo.scm
	* plug-ins/script-fu/scripts/starscape-logo.scm
	* plug-ins/script-fu/scripts/textured-logo.scm
	* plug-ins/script-fu/scripts/title-header.scm
	* plug-ins/script-fu/scripts/waves-anim.scm
	* plug-ins/xjt/xjt.c: changed accordingly.
2005-07-10 21:17:22 +00:00
7123168f22 there's no need to keep a reference to the anchor button.
2005-06-15  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimplayertreeview.[ch]: there's no need to keep a
	reference to the anchor button.
2005-06-15 14:52:01 +00:00
93eab43eef Use the canonical form for signal names.
2005-05-27  Sven Neumann  <sven@gimp.org>

	* (lots of files): Use the canonical form for signal names.
2005-05-27 16:51:39 +00:00
2a08c79b2b app/actions/layers-actions.c app/core/gimpimage.c
2005-05-06  Sven Neumann  <sven@gimp.org>

	* app/actions/layers-actions.c
	* app/core/gimpimage.c (gimp_image_position_layer)
	* app/widgets/gimplayertreeview.c (gimp_layer_tree_view_drop_possible):
	drop the limitation that layers not at the bottom of the stack
	have to have an alpha channel. Allow the user to move the
	background layer up in the stack or reposition it using DND.

	* tips/gimp-tips.xml.in: changed the relevant tip and some more.
2005-05-06 20:45:21 +00:00
7609645970 Implement dragging and dropping in any GdkPixbuf supported format. Fixes
2005-04-09  Michael Natterer  <mitch@gimp.org>

	Implement dragging and dropping in any GdkPixbuf supported
	format. Fixes bug #172794 and bug #172795.

	* app/core/gimplayer.[ch] (gimp_layer_new_from_region): new
	function which contains all stuff that was in
	gimp_layer_new_from_tiles().

	(gimp_layer_new_from_tiles): use above function.
	(gimp_layer_new_from_pixbuf): new function.

	* app/widgets/Makefile.am
	* app/widgets/gimppixbuf.[ch]: new files containing GdkPixbuf
	utility functions for clipboard and DnD.

	* app/widgets/gimpselectiondata.[ch]: removed
	gimp_selection_data_set,get_pixbuf(), GTK+ provides the same API.
	Also removed GdkAtom parameters all over the place because it's
	always the same as selection_data->target.

	* app/widgets/gimpclipboard.c: use the new pixbuf utility
	functions and gtk_selection_data_set,get_pixbuf().

	* app/widgets/widgets-enums.h
	* app/widgets/gimpdnd.[ch]: removed never-implemented
	GIMP_DND_TYPE_PNG and added a generic GIMP_DND_TYPE_PIXBUF
	instead. Added API to drag and drop GdkPixbufs which transparently
	converts from/to and GdkPixbuf-supported image format. Removed
	passing around of GdkAtoms, since they were always the same
	as selection_data->target.

	* app/widgets/gimpdnd-xds.[ch]: follow GdkAtom parameter removal.

	* app/widgets/gimpcontainertreeview.[ch]: added virtual function
	GimpContainerTreeView::drop_pixbuf().

	* app/widgets/gimpcontainertreeview-dnd.c: dispatch drop_pixbuf().

	* app/widgets/gimplayertreeview.c: implement drop_pixbuf().

	* app/widgets/gimpdrawabletreeview.c: allow to drag all drawables
	as pixbufs.

	* app/display/gimpdisplayshell-dnd.c: allow dropping of pixbufs.
2005-04-09 17:56:04 +00:00
b8cf0e436f make "preview-size" and "preview-border-width" construct properties. Fixes
2005-03-18  Sven Neumann  <sven@gimp.org>

	* app/widgets/gimpcontainerview.c: make "preview-size" and
	"preview-border-width" construct properties. Fixes creation
	using g_object_new().

	* app/widgets/gimpcontainerentry.c
	* app/widgets/gimpcontainertreeview.c
	* app/widgets/gimplayertreeview.c (set_preview_size): handle
	unset model and/or view gracefully.

	* app/dialogs/image-new-dialog.c: unset "focus-on-click" on the
	template combo-box.
2005-03-18 00:31:29 +00:00
86b62f7e1c undeprecated the paint mode menu (ported to GimpEnumComboBox with
2005-02-08  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpwidgets-constructors.[ch]: undeprecated the
	paint mode menu (ported to GimpEnumComboBox with separators).
	The separator code is quite hackish and therefore still
	implemented privately here.

	* app/widgets/gimpbrushselect.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimppropwidgets.c: changed accordingly.
2005-02-08 20:07:08 +00:00
0429d04908 Allow to drop stuff onto empty layers, channels and paths dialogs to
2005-01-17  Michael Natterer  <mitch@gimp.org>

	Allow to drop stuff onto empty layers, channels and paths dialogs
	to create new items:

	* app/widgets/gimpcontainertreeview.h (struct GimpContainerTreeView):
	added "gboolean dnd_drop_to_empty".

	* app/widgets/gimpcontainertreeview-dnd.c: if "dnd_drop_to_empty"
	is TRUE, dispatch drops to empty views and to the empty area below
	all items.

	* app/widgets/gimpitemtreeview.c (gimp_item_tree_view_init): set
	"dnd_drop_to_empty" to TRUE.

	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimpchanneltreeview.c
	* app/widgets/gimpdrawabletreeview.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpvectorstreeview.c: made all drop functions work
	with "dest_viewable" being NULL and changed drop_possible()
	implementations accordingly. Cleaned up the whole DND code a bit.

	* app/widgets/gimplayertreeview.c: removed color and pattern
	drop code...

	* app/widgets/gimpdrawabletreeview.c: and added it here so colors
	and patterns can be dropped to the channels dialog too.
2005-01-17 15:28:08 +00:00
e5c0d8eb0e app/core/gimpitem.c app/core/gimpdrawable.c made GimpItem::scale() and
2005-01-15  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpitem.c
	* app/core/gimpdrawable.c
	* app/vectors/gimpvectors.c: made GimpItem::scale() and ::resize()
	work on unattached items.

	* app/widgets/gimplayertreeview.c
	(gimp_layer_tree_view_drop_component): fix drop index.

	* app/widgets/gimpchanneltreeview.c: implement dropping of
	components as new channels. Fixes bug #158483.
2005-01-15 19:17:11 +00:00
63c933aef7 added virtual function GimpContainerTreeView::drop_component(). Added EEKy
2005-01-15  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpcontainertreeview.[ch]: added virtual function
	GimpContainerTreeView::drop_component(). Added EEKy "dnd_gimp"
	needed for gimp_selection_data_get_component().

	* app/widgets/gimpitemtreeview.c (gimp_item_tree_view_set_context):
	set the "dnd_gimp" pointer if it is NULL.

	* app/widgets/gimpcontainertreeview-dnd.c: handle component drops
	and dispatch ::drop_component() accordingly.

	* app/widgets/gimplayertreeview.c: implement dropping of
	components as new layers. Addresses bugs #158483 and #158133.
2005-01-15 17:57:32 +00:00
bb3a6002cf handle drops of items of all types from all images and convert them if
2005-01-15  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpitemtreeview.c
	(gimp_item_tree_view_drop_viewable): handle drops of items of all
	types from all images and convert them if needed.

	* app/widgets/gimplayertreeview.c: enable dropping of all kinds of
	drawables. Addresses bug #158133.
2005-01-15 03:24:42 +00:00
b13aded024 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/actions/documents-commands.c
	* app/actions/file-commands.c
	* app/dialogs/file-open-dialog.c
	* app/dialogs/file-open-location-dialog.c
	* app/display/gimpdisplayshell-dnd.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimptoolbox-dnd.c: undo changes of 12-24,
	in favor of a better fix.

	* app/widgets/gimperrordialog.c: fix bug #162147 properly,
	as suggested by mitch.
2004-12-26 17:11:31 +00:00
59e86d02fb Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/actions/documents-commands.c
	* app/actions/file-commands.c
	* app/dialogs/file-open-dialog.c
	* app/dialogs/file-open-location-dialog.c
	* app/display/gimpdisplayshell-dnd.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimptoolbox-dnd.c: replace % with space
	in file name before showing error message,
	fixes bug #162147.

	* app/core/gimp-gui.c
	* app/widgets/gimpmessagebox.c: be a bit more paranoid
	about validating utf8 for messages.
2004-12-24 19:11:30 +00:00
fd6d30fd30 When there are variants of actions with and without dialog, let the
2004-10-23  Michael Natterer  <mitch@gimp.org>

	When there are variants of actions with and without dialog, let
	the dialog-less actions try to use the values from the last dialog
	invocation:

	* app/actions/channels-actions.c
	* app/actions/channels-commands.[ch]
	* app/actions/layers-actions.c
	* app/actions/layers-commands.[ch]
	* app/actions/vectors-actions.c
	* app/actions/vectors-commands.[ch]: renamed the foo-new-defaults
	actions to foo-new-last-values and use the last values entered in
	the dialogs.

	* app/widgets/gimpchanneltreeview.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpvectorstreeview.c: changed accordingly. Show
	the dialog on clicking "New" and call the last-values action on
	<shift>+click.

	* app/actions/select-actions.c
	* app/actions/vectors-commands.c: renamed the foo-stroke-last-vals
	to -last-values.

	* app/widgets/gimpselectioneditor.c
	* app/widgets/gimpvectorstreeview.c: stroke with last values on
	<shift> clicking the stroke buttons.
2004-10-23 00:53:48 +00:00
c84475c989 moved "item_type" and "signal_name" from GimpItemTreeView to
2004-10-16  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimpitemtreeview.[ch]: moved "item_type" and
	"signal_name" from GimpItemTreeView to GimpItemTreeViewClass.
	Removed them from gimp_item_tree_view_new(). Require the view_type
	instead of item_type in gimp_item_tree_view_new().

	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimpdrawabletreeview.c (get_type): made them
	abstract base classes.

	* app/widgets/gimpchanneltreeview.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpvectorstreeview.c (class_init): set the
	item_type and signal_name members if GimpItemTreeViewClass.

	* app/dialogs/dialogs-constructors.c: changed accordingly.
2004-10-16 20:17:30 +00:00
f4d7260c64 app/actions/channels-actions.c app/actions/colormap-editor-actions.c
2004-10-16  Michael Natterer  <mitch@gimp.org>

	* app/actions/channels-actions.c
	* app/actions/colormap-editor-actions.c
	* app/actions/documents-actions.c
	* app/actions/tool-options-actions.c
	* app/actions/vectors-actions.c: added more tooltips for actions
	which are used as extended dialog button callbacks.

	* app/widgets/gimpeditor.c (gimp_editor_add_action_button): keep
	the list of extended actions in reverse order.

	* app/widgets/gimpchanneltreeview.c
	* app/widgets/gimpcolormapeditor.c
	* app/widgets/gimpdocumentview.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpselectioneditor.c
	* app/widgets/gimptooloptionseditor.c
	* app/widgets/gimpvectorstreeview.c: don't set the tooltips
	manually. Removes another bunch of insane translatable multiline
	format strings. Pass the extended actions in the right order
	to gimp_editor_add_action_button().
2004-10-16 17:10:04 +00:00
8effb0cfaf Ported the layers, channels and paths dialogs from
2004-10-16  Michael Natterer  <mitch@gimp.org>

	Ported the layers, channels and paths dialogs from
	gimp_editor_add_button() to gimp_editor_add_action_button(),
	removing a massive amount of duplicated code, sensitivity logic
	and confusing utility functions.

	* app/actions/channels-actions.c
	* app/actions/channels-commands.[ch]
	* app/actions/layers-actions.c
	* app/actions/layers-commands.[ch]
	* app/actions/vectors-actions.c
	* app/actions/vectors-commands.[ch]: added "foo-new-default"
	actions and callbacks which create items without a dialog,
	optionally using default values from a passed template. Removed
	all public utility function that were passed as function pointers
	to widget construtors. Added tooltips to all actions which are now
	used for dialog buttons.

	* app/widgets/gimpeditor.c (gimp_editor_add_action_button):
	automatically create multi-line tooltips showing the modifiers for
	extended action buttons. Removes the need for lots of insane
	format strings that need to be translated correctly.

	* app/widgets/gimpitemtreeview.[ch] (struct GimpItemTreeViewClass):
	replaced tooltip and help_id strings by action names.

	(struct GimpItemTreeView)
	(gimp_item_tree_view_new): removed "edit", "new" and "activate"
	function pointers.

	(gimp_item_tree_view_constructor): create all buttons
	with gimp_editor_add_action_button(), using the action names
	from GimpItemTreeViewClass.

	Removed tons of "clicked" callbacks and all code which sets the
	buttons' sensitivity. They are not needed any longer.

	Require all subclasses to implement GimpItemTreeView::new_item(),
	a new virtual function which creates a plain new item without
	showing a dialog.

	* app/widgets/gimpdrawabletreeview.c
	* app/widgets/gimpchanneltreeview.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimpvectorstreeview.c: fill in the action names and
	implement GimpItemTreeView::new_item(). Removed all button
	sensitivity logic.

	* app/dialogs/dialogs-constructors.c: changed accordingly. Doesn't
	include anything from actions/ any more.
2004-10-16 15:48:23 +00:00
10d80dac75 removed the hack that was displaying "Floating Selection" instead of the
2004-09-22  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimplayertreeview.c
	(gimp_layer_tree_view_floating_selection_changed): removed the
	hack that was displaying "Floating Selection" instead of the
	floating layer's real name.

	* app/core/gimplayer.c: implement GimpViewable::get_description()
	instead and special case floating selections with a two-line
	text that contains "Floating Selection".

	* app/core/gimplayer-floating-sel.c
	* app/core/gimpimage-undo-push.c: emit "name_changed" on the layer
	when it changes its state from floating to normal or vice versa
	so the views can update accordingly.

	* app/core/gimpselection.c: s/"Selection"/"Floated Layer"/.

	* app/tools/gimpeditselectiontool.c:
	s/"Floating Layer"/"Floating Selection"/.
2004-09-22 12:46:35 +00:00
c3ef897b10 Try to make floating selections more obvious:
2004-09-19  Sven Neumann  <sven@gimp.org>

	Try to make floating selections more obvious:

	* app/widgets/gimplayertreeview.c
	(gimp_layer_tree_view_floating_selection_changed): always display
	"Floating Selection" as the name for a floating selection.

	* app/core/gimpselection.c (gimp_selection_float): call the new
	layer "Selection" instead of "Floating Selection". This is what
	will be displayed if the FS is turned into a layer.

	* app/actions/layers-commands.c (layers_edit_layer_query): don't
	special case floating selections here.

	* app/core/gimplayer-floating-sel.c: cosmetics.
2004-09-19 16:56:03 +00:00
6a723efc4b app/actions/layers-actions.c added actions and callbacks
2004-09-15  Michael Natterer  <mitch@gimp.org>

	* app/actions/layers-actions.c
	* app/actions/layers-commands.[ch]: added actions and callbacks
	"layers-preserve-transparency" and
	"layers-paint-mode-first,last,previous,next". Update the "active"
	state of the recently added layer mask property actions in
	layers_actions_update().

	* app/actions/drawable-actions.c
	* app/actions/drawable-commands.[ch]: added actions and callbacks
	for "drawable-visible" and "drawable-linked". Fixes bug #152597.

	* app/actions/vectors-actions.c
	* app/actions/vectors-commands.[ch]: same here ("vectors-visible"
	and "vectors-linked").

	* app/widgets/gimplayertreeview.c
	(gimp_layer_tree_view_preserve_button_toggled): flush the image
	so the new actions are updated. Compress preserve_trans undos.

	* menus/image-menu.xml.in: added the layer mask property actions
	to the Layers/Mask submenu.

	* menus/layers-menu.xml: reordered the mask property actions
	to have the same order as in the image menu.
2004-09-15 13:24:45 +00:00
e91187ae86 app/widgets/gimppreview-popup.c renamed these files...
* app/widgets/gimppreview-popup.c
* app/widgets/gimppreview-popup.h: renamed these files...

* app/widgets/gimpview-popup.c
* app/widgets/gimpview-popup.h: .. to these files, and changed the
  GimpPreviewPopup type to GimpViewPopup.

* app/widgets/gimppreviewrenderer.c
* app/widgets/gimppreviewrenderer.h: renamed these files...

* app/widgets/gimpviewrenderer.c
* app/widgets/gimpviewrenderer.h: .. to these files, and changed
  GimpPreviewRenderer to GimpViewRenderer.

This is the second step of the great Preview->View renaming process.

* app/display/gimpdisplayshell-layer-select.c
* app/display/gimpnavigationeditor.c

* app/widgets/Makefile.am
* app/widgets/gimpbrushfactoryview.c
* app/widgets/gimpbufferview.c
* app/widgets/gimpcellrendererviewable.c
* app/widgets/gimpcellrendererviewable.h
* app/widgets/gimpcomponenteditor.c
* app/widgets/gimpcontainerbox.c
* app/widgets/gimpcontainercombobox.c
* app/widgets/gimpcontainereditor.c
* app/widgets/gimpcontainerentry.c
* app/widgets/gimpcontainergridview.c
* app/widgets/gimpcontainerpopup.c
* app/widgets/gimpcontainertreeview-dnd.c
* app/widgets/gimpcontainertreeview.c
* app/widgets/gimpcontainerview.c
* app/widgets/gimpdatafactoryview.c
* app/widgets/gimpitemtreeview.c
* app/widgets/gimplayertreeview.c
* app/widgets/gimpnavigationpreview.c
* app/widgets/gimppatternfactoryview.c
* app/widgets/gimppreviewrenderer-utils.c
* app/widgets/gimppreviewrendererbrush.c
* app/widgets/gimppreviewrendererbrush.h
* app/widgets/gimppreviewrendererdrawable.c
* app/widgets/gimppreviewrendererdrawable.h
* app/widgets/gimppreviewrenderergradient.c
* app/widgets/gimppreviewrenderergradient.h
* app/widgets/gimppreviewrendererimage.c
* app/widgets/gimppreviewrendererimage.h
* app/widgets/gimppreviewrendererimagefile.c
* app/widgets/gimppreviewrendererimagefile.h
* app/widgets/gimppreviewrendererlayer.c
* app/widgets/gimppreviewrenderervectors.c
* app/widgets/gimpselectioneditor.c
* app/widgets/gimptemplateview.c
* app/widgets/gimptooloptionseditor.c
* app/widgets/gimptoolview.c
* app/widgets/gimpview.c
* app/widgets/gimpview.h
* app/widgets/gimpviewablebutton.c
* app/widgets/widgets-enums.h
* app/widgets/widgets-types.h: Modified accordingly.
2004-08-25 22:31:44 +00:00
c04ddea85e app/actions/layers-actions.[ch] app/actions/layers-commands.[ch] added
2004-08-21  Sven Neumann  <sven@gimp.org>

	* app/actions/layers-actions.[ch]
	* app/actions/layers-commands.[ch]
	* app/widgets/gimplayertreeview.c: added actions to handle layer
	masks as suggested in bug #150446.

	* menus/layers-menu.xml: added menu entries for new actions,
	commented out raise/lower menu entries.
2004-08-20 22:32:14 +00:00
02d2b990f5 Redid the whole internal progress stuff: don't pass around
2004-08-10  Michael Natterer  <mitch@gimp.org>

	Redid the whole internal progress stuff: don't pass around
	progress_callback and progress_data; instead, provide a
	pointer to a GimpProgressInterface which can be implemented
	by a variety of backends.

	Addresses (but not yet fixes) bugs #6010, #97266 and #135185.

	* app/display/Makefile.am
	* app/display/gimpprogress.[ch]: removed the old progress hack.

	* app/core/Makefile.am
	* app/core/core-types.h
	* app/core/gimpprogress.[ch]: implement GimpProgressInterface.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpprogressdialog.[ch]: the standalone progress
	dialog as widget implementing GimpProgressInterface.

	* app/display/gimpdisplay.c
	* app/display/gimpstatusbar.[ch]
	* app/widgets/gimpfiledialog.[ch]
	* app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface
	implementation to these classes.

	* app/core/gimp-gui.[ch]
	* app/gui/gui-vtable.c: replaced the old progress vtable entries
	by two new to create and destroy a GimpProgressDialog in case
	no other progress is available.

	* app/pdb/procedural_db.[ch]
	* app/plug-in/plug-in-run.[ch]
	* tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and
	all plug-ins.

	* app/plug-in/plug-in.[ch]
	* app/plug-in/plug-ins.c
	* app/plug-in/plug-in-message.c
	* app/plug-in/plug-in-progress.c: handle the case there the
	plug-in was crated with a progress as well as the case where it
	wasn't.

	* app/app_procs.c
	* app/batch.c
	* app/xcf/xcf.c
	* app/file/file-open.[ch]
	* app/file/file-save.[ch]
	* app/widgets/gimphelp.c
	* app/widgets/gimpbrushselect.c
	* app/widgets/gimpfontselect.c
	* app/widgets/gimpgradientselect.c
	* app/widgets/gimppaletteselect.c
	* app/widgets/gimppatternselect.c: changed accordingly.

	* app/core/gimpimagefile.[ch]
	* app/display/gimpdisplayshell-dnd.c
	* app/gui/file-open-dialog.c
	* app/gui/file-open-location-dialog.c
	* app/gui/file-save-dialog.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file
	related functions. Embed the progress in the file dialog where
	possible.

	* app/core/gimpdrawable-blend.[ch]
	* app/core/gimpdrawable-transform.[ch]
	* app/core/gimpimage-convert.[ch]
	* app/core/gimpimage-flip.[ch]
	* app/core/gimpimage-resize.[ch]
	* app/core/gimpimage-rotate.[ch]
	* app/core/gimpimage-scale.[ch]
	* app/core/gimpitem-linked.[ch]
	* app/core/gimpitem.[ch]
	* app/core/gimpchannel.c
	* app/core/gimpdrawable.c
	* app/core/gimplayer.c
	* app/core/gimpselection.c
	* app/vectors/gimpvectors.c: replaced callback/data by GimpProgress.

	* app/tools/gimpblendtool.c
	* app/tools/gimptransformtool.c
	* app/gui/convert-dialog.c
	* app/actions/documents-commands.c
	* app/actions/file-commands.c
	* app/actions/image-commands.c
	* app/actions/layers-commands.c
	* app/actions/plug-in-commands.c
	* app/actions/vectors-commands.c
	* tools/pdbgen/pdb/convert.pdb
	* tools/pdbgen/pdb/edit.pdb
	* tools/pdbgen/pdb/image.pdb
	* tools/pdbgen/pdb/layer.pdb: changed callers accordingly.

	* app/pdb/*_cmds.c: regenerated.
2004-08-10 18:47:21 +00:00
0dabeab6cb #include "core/gimpimage-undo.h"
2004-08-04  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimplayertreeview.c: #include "core/gimpimage-undo.h"
2004-08-04 10:15:49 +00:00
b909c2b2ee new function which checks if undo compression is possible:
2004-08-03  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpimage-undo.[ch] (gimp_image_undo_can_compress):
	new function which checks if undo compression is possible:

	(1) is the image dirty? Fixes bug #148853.
	(2) is redo stack empty?
	(3) do both the passed undo object_type and undo_type
	    match the top undo item?

	Consistently name the GType and GimpUndoType passed to undo
	functions "object_type" and "undo_type" to avoid confusion.

	* app/actions/layers-commands.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimptexttool.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimplayertreeview.c: use the new utility function
	instead of checking the above conditions manually.
2004-08-03 14:09:49 +00:00
744bebc83c app/widgets/Makefile.am moved to libgimpwidgets.
2004-07-26  Sven Neumann  <sven@gimp.org>

	* app/widgets/Makefile.am
	* app/widgets/gimpcellrenderertoggle.[ch]: moved to libgimpwidgets.

	* app/widgets/gimpcomponenteditor.c
	* app/widgets/gimpcontainertreeview.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimptoolview.c
	* app/widgets/widgets-types.h

	* libgimpwidgets/Makefile.am
	* libgimpwidgets/gimpwidgets.def
	* libgimpwidgets/gimpwidgets.h
	* libgimpwidgets/gimpwidgetsmarshal.list
	* libgimpwidgets/gimpwidgetstypes.h
	* libgimpwidgets/gimpcellrenderertoggle.[ch]: custom toggle cell
	renderer moved here from app/widgets.

	* libgimpwidgets/gimpcellrenderercolor.[ch]: unified code with the
	new toggle cell renderer.
2004-07-26 21:09:16 +00:00